KEGG   Rivularia sp. PCC 7116: Riv7116_2130Help
Entry
Riv7116_2130      CDS       T02364                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00051  Fructose and mannose metabolism
riv00520  Amino sugar and nucleotide sugar metabolism
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:riv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Riv7116_2130
   00520 Amino sugar and nucleotide sugar metabolism
    Riv7116_2130
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Riv7116_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer CRF-BP
Motif
Other DBs
NCBI-ProteinID: AFY54660
UniProt: K9R9Q1
Position
2633567..2634631
Genome map
AA seq 354 aa AA seqDB search
MTKRLFPVILAGGKGERFWPLSRRTRPKQFLNLDGTSRSLMQATADRLLPLTDGWDSLWV
ITSSLIAEGVKEQLPELPEANLLVEPQGRDTAAAVAWASLEIKKRYGEDAIIGFFPADHW
IADQEAFASTLNAAAELAAQNPAIVTLGIKPTFPSTGYGYIEQGEKFGSFNNLPAYHVNR
FTEKPDRDTAETFLQTGRFSWNSGMFFFRAGVVIKELYTYAPEIIEPIEKNGPSIYPELP
KLSVDYALMEKTNLAYVLPVEFGWDDLGDWNAIERLLKKEKEPNVELATHVGLDTQGAIL
YASNEDDVIVTIGLEDVVVVRDKNVTLIVKKERTQEIKQVLKNLQSDSRFTELL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacgattgtttcccgtaattcttgcaggtggtaagggcgaacgtttttggcct
ctttctcgacgaacccgacctaagcaatttttaaatcttgatggcacctctcgaagctta
atgcaagccactgctgacaggctgttaccgctgactgatggttgggattccttatgggtg
ataacttctagcctgatagcagaaggcgtaaaagaacaattaccagaattgcctgaagcc
aacttgcttgtagaaccacaaggaagagatacggcagcagcagttgcctgggctagtttg
gaaattaaaaagcgttatggtgaagacgctattattggctttttccctgccgaccactgg
atcgccgaccaagaggcatttgcaagcacattaaatgcagcagccgaattagccgcacaa
aatccggcgattgtaacgctcgggatcaaaccaacatttccatcaacaggctatggctac
atagaacagggtgaaaaatttggtagctttaacaacttgccagcctaccacgttaatcgc
tttactgaaaagcccgaccgagacacggcggaaacttttttacaaacgggacgctttagc
tggaatagtggaatgttcttttttagagcaggggttgttatcaaagaattatatacttat
gctccagaaatcatcgaacccatagaaaaaaatggtccttctatttatcccgagctgcca
aaactaagtgtagactatgctttgatggaaaagaccaatctagcatacgtcttaccagta
gaatttggctgggacgatctaggagactggaacgccattgaaaggttgcttaaaaaagaa
aaagaaccaaacgtcgaattagctactcatgtaggattagacacccaaggagccattctc
tacgccagcaatgaagatgacgtaattgttactattggtctagaagatgtagtcgtcgtt
cgcgacaagaatgtcactttaattgtcaaaaaagaacgcacccaagaaattaaacaggta
cttaaaaatctacagtccgattctcgctttaccgaactactttaa

DBGET integrated database retrieval system