KEGG   Rivularia sp. PCC 7116: Riv7116_3320Help
Entry
Riv7116_3320      CDS       T02364                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Riv7116_3320
Enzymes [BR:riv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Riv7116_3320
Transporters [BR:riv02000]
 Other Transporters
  Pores ion channels [TC:1]
   Riv7116_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_6 Glutaredoxin GST_C
Motif
Other DBs
NCBI-ProteinID: AFY55783
UniProt: K9RE71
Position
4124331..4125125
Genome map
AA seq 264 aa AA seqDB search
MLELYQFELSQYSEKVRLILDYKGLEYRKIEVTPGIGQVELFQKTGQRQVPVLKDGNKYI
ADSTEIAKYIDAQHPERPLIPQDPKTRGLCLMMEEWADESIGTKSRKALFSAISKDQYLR
KALLPNSTPDLLKTLVEGVPPDILKVLGVGVGYSPDVVQGAMRDLEQDLEALTLILESSP
YLLGDEPCLADFAVAGLSVLLKFPDGNYLDLPDTIKGKGVPGLADNPIYQPFFDWRDRLY
VQFRKPIIGSTINSPSAPTSIQID
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttagagttgtaccaatttgaactttctcagtactcagaaaaagttcgtttgattcta
gactataaaggtctggaataccgcaaaatagaggtgacaccgggtatcggtcaagttgag
ctatttcaaaaaacagggcaacgtcaagtaccagtacttaaagatggcaataaatatata
gctgattctactgaaatagctaagtatatagatgcacagcatcccgagcgtcctttgatt
cctcaagaccctaaaactcggggattatgcttaatgatggaagaatgggcggatgaatct
atcggcaccaaaagtagaaaagctttattttctgccattagtaaagaccagtatttgcgt
aaagcgttattgcctaactctacaccagacctactaaaaaccttagtagaaggagttcct
cctgatattttaaaagtgttaggtgtaggtgtaggttacagccccgatgtcgtacagggc
gcaatgagagacttagagcaagatttagaagctttgacattaatattagaaagcagcccc
tatttattaggagatgaaccctgtctggctgattttgcagtcgctggtttatctgtgtta
ttaaaattcccagatggtaattatttagatttaccagacacgattaaaggtaaaggagta
cccggtttagcagacaatccgatttatcaaccgttttttgactggcgcgatagactttac
gttcaattccgtaaaccaataatcggttctacaattaacagtccgagtgccccgacatct
attcagattgattaa

DBGET integrated database retrieval system