KEGG   Rivularia sp. PCC 7116: Riv7116_3848Help
Entry
Riv7116_3848      CDS       T02364                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00010  Glycolysis / Gluconeogenesis
riv00052  Galactose metabolism
riv00500  Starch and sucrose metabolism
riv00520  Amino sugar and nucleotide sugar metabolism
riv00521  Streptomycin biosynthesis
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01120  Microbial metabolism in diverse environments
riv01130  Biosynthesis of antibiotics
riv01200  Carbon metabolism
Module
riv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riv7116_3848
   00052 Galactose metabolism
    Riv7116_3848
   00500 Starch and sucrose metabolism
    Riv7116_3848
   00520 Amino sugar and nucleotide sugar metabolism
    Riv7116_3848
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Riv7116_3848
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Riv7116_3848
Enzymes [BR:riv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Riv7116_3848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFY56291
UniProt: K9RFM9
Position
complement(4791677..4792570)
Genome map
AA seq 297 aa AA seqDB search
MLTQVIGIDLGGTAIKLGRFTSDGSCLKSLSVHTPQPATPEAVVAAIVDAIARVDPEGNA
VAIGVGTPGPADAQGRIAKIAINLPQWRNIPLADTLEEKIGKPTIIDNDANCAGLGEAWL
GAGRFYKNFILLTLGTGVGGAIFIDGKLFTGKFGAAGELGLISVNPNGSQCKSGNRGSLE
QHTSVIAIRRRSGKEPAELGTLAKTGNKEALKFWQEYGKDLGIGVTSLIYVLTPEAVVIG
GGVSASFEFFLPSMKAEIEQRVMPTSRVNLQIVRAHLGNGAGMLGAAKLAIEKFINN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctaactcaagtaattggtattgatctgggaggaacggcaatcaaattaggacgattt
acgtctgatggttcttgtttaaaatctttgagcgtgcatactccccaaccagcaacacca
gaagcggtagtggcagctattgttgatgcaatagccagagtagatccagaaggaaatgca
gttgcaatcggtgttggaactccaggcccagccgatgcccagggacgcattgctaaaatt
gcgattaatcttcctcaatggcggaacattcctttagcggacactttggaagagaaaatc
ggtaagcctacaattattgataatgatgcaaactgcgcgggtttgggtgaagcttggctt
ggtgcaggacgtttttataaaaattttattttactgactttaggtactggcgttggtgga
gctatttttattgatggtaaattatttacaggaaaatttggagccgcaggagaattaggc
ttaattagtgtaaatcctaatggttcgcaatgtaaaagcggtaatcgaggttctttggaa
cagcatacttcggtaatcgcaattcgtcgccgtagtggtaaagaaccggcagaattaggt
actttagctaaaactggaaataaagaagcgttgaagttttggcaggagtatggtaaggat
ttgggaattggagtcacaagtttaatttatgtgctaacacctgaagctgttgtaattgga
ggcggtgttagtgcaagtttcgagtttttcctaccgtcaatgaaagcagaaattgagcag
cgagtaatgcccacatctcgcgtaaatttacaaatagtaagggcgcacttaggtaatggc
gcgggaatgttgggtgctgcaaaactggcgattgaaaagtttatcaataattaa

DBGET integrated database retrieval system