KEGG   Rivularia sp. PCC 7116: Riv7116_4228Help
Entry
Riv7116_4228      CDS       T02364                                 

Definition
(GenBank) cobaltochelatase CobN subunit
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00860  Porphyrin and chlorophyll metabolism
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Riv7116_4228
Enzymes [BR:riv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Riv7116_4228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479
Motif
Other DBs
NCBI-ProteinID: AFY56659
UniProt: K9RH57
Position
complement(5295777..5299574)
Genome map
AA seq 1265 aa AA seqDB search
MKRIVLIAGFESFNAGLYRQAADMAVSRCSDLDIRVFSDRDINSKQVEVETALQGADVFF
GSLLFDYDQVLWLRERVSDIPIRLVFESALELMSCNKIGDFAIGDKPKGMPKPVKFILDK
FGNGREEDKLAGYISFLKIGPKLLKFVPVQKVQDLRNWLIIYGYWNAGGSENVASLFWTL
AEKYLDLKVGNIPAPLETPNMGLLHPDYDGYFESPQEYLAWYEKRKIPPSPPYERGEENA
DGLEITAYKQEHLSPPSQGGLGESETRNKVIGILLYRKHVITKQPYIPQLIKRFEEAGLI
PLPIFINGVEGHVAVRDWMTTDYETQQREQGNKITLSLSPEAAKVDAIVSTIGFPLVGGP
AGSMEAGRQVDIAKGILAAKNVPYIVAAPLLIQDIHSWTRQGIGGLQSVVLYALPELDGA
IDTVPLGGLVGEDIYLVPERVQRLIGRVKSWVNLRQKPASERKIAVILYGFPPGYGATGT
AALLNVPRSLLNFLQGLKQQGYDVGELPEDGEELIRLVKEADESYSENNVEMLNLTSQNT
VNVRKLEKWLGYLQTSRVEKQWKSLTGSGIKTYGDRFHLGGVQLGNVWIGVQPPLGIQGD
PMRLMFERGLTPHPQYAAYYKWLQNDFAADALVHFGMHGTVEWLPGSPLGNTGYSWSDIL
LGDLPNLYIYAANNPSESILAKRRGYGVLISHNVPPYGRAGLYKELMALRDLVAEYREDP
QKNYALKEGICKKIIDSGLDADCPFEEAKKLGIEFTPENIGMFSQNVFDDYLVKLYEYLQ
VLENRLFSSGLHVLGAAPNQEEMQSYLDAYFGEEEEENQPQSYRVSRGEEEERIKDLLKQ
STDELKNLLRGLNGEYIPPAPGGDLLRDGAGVLPTGRNIHALDPYRMPSPAAYERGREVA
RKIIQQHLQENGSYPETVAVMLWGLDAIKTKGESLGILLELVGAEPVKEGTGRIVRYELK
PLVEVGHPRIDVLGNLSGIFRDSFVNIIELLDDLFQRAADVDEPVDKNFIRKHALELKQK
GVENTSARLFSNPAGDFGSLVNDRVVDSNWESSDELANTWQSRNVFSYGRQDKGQARPEV
LNQLLGSTSQIVQEIDSVEYGLTDIQEYYGNTGGLKKAAEKQAGKKVKASFVESFSKDTT
PRYLDDLLRMEYRTKLLNPKWAEAMVNQGSGGAFEVSQRMTALIGWGGTADFTDEWVYEQ
AADTYALDAEMAEKLRKANPEAFKNIVGRMLEAHGRGFWDASDEKLQKLRELYELTDEQL
EGVTV
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtatcgtcttgattgcagggtttgaatctttcaacgctggtttgtaccgccaa
gctgctgatatggctgtatctcgctgtagtgatttggatattcgggtgtttagcgatcgc
gatatcaacagcaaacaagttgaggttgaaactgcacttcaaggcgctgatgtgtttttt
ggtagtttgctattcgactacgatcaagttttatggttaagggaacgagtcagcgatatt
cccattcgcttggtgtttgagtcagctttggagttgatgagttgcaacaaaatcggggat
tttgcaattggtgataaacccaagggaatgcccaagcctgtaaaatttatcttggataag
tttggaaacgggcgcgaagaagataaacttgctggctatattagcttcttaaaaattggt
cccaaactattaaaatttgtaccggtacaaaaggttcaagatttacgcaactggttaatt
atctatggttattggaatgctggtggttccgaaaatgtcgcttcattgttttggacgcta
gcagaaaaatatttagatttaaaagtcggcaatattcccgcacctttagaaactccgaat
atgggattgcttcatcccgattacgacggttattttgaatctccgcaggaatatttggca
tggtacgagaaacggaagatcccccctagccccccttatgaaaggggggaagaaaacgcc
gatggtttagaaattactgcttataaacaagaacatttaagccccccttctcaagggggt
ttgggggaatctgaaactcgaaataaagtaatcggaattcttttatatagaaaacacgta
attacaaaacaaccatacatcccccaattaatcaaacgctttgaagaagctggtttaatt
cccttaccgatattcatcaatggtgtggaaggacatgtcgcagtacgcgattggatgact
acggattacgaaactcagcaacgcgaacaaggtaataagataactctttctctttcccca
gaagcggcaaaagttgatgcaattgtttctactatcggatttcctttggtgggtggcccc
gcaggctctatggaagcgggaagacaggtagatattgccaagggaattctggcagctaaa
aatgtaccttatattgttgccgcacctttgttgattcaagatattcattcctggactcgt
cagggtattggcggattacaaagcgtcgttttatacgcactgccggaacttgatggagca
attgacacggttcccctcggtggtttggttggggaagatatttatttggttccggaaagg
gtacaaaggttaattggcagggtgaaaagttgggtaaatctccgacaaaaacctgcctcg
gagcgcaaaattgccgttattctttacggttttccaccgggatacggtgcgacgggtact
gctgctttattaaatgtaccgcgcagtttgctgaactttttgcaaggtttgaagcaacaa
ggttacgacgttggggaattaccagaagatggggaggagttgattcgtttggtgaaggaa
gcagatgaatcctactccgaaaataatgtagagatgttgaatttaacgtctcaaaatact
gtaaatgtcaggaagttggaaaaatggctgggatatctccaaacaagccgtgttgaaaag
cagtggaaatcgctgactggttcgggtatcaaaacttatggcgatcggtttcatctcggt
ggtgttcaattaggtaatgtttggattggagttcagccaccgttaggtattcaaggcgac
ccgatgcggttgatgtttgaacgaggtttaacgccgcatccccaatatgctgcttattac
aagtggttgcagaatgattttgctgccgatgcgctggttcattttggaatgcacggcact
gtggaatggttgcccggttcgcctttaggaaatactggttattcttggtctgatatttta
cttggagatttgcccaacctatatatttatgctgcgaataatccttcggaatcaattttg
gcgaagcgtcgcggttatggggtgttgatttcccataatgtaccgccttacggacgtgcg
ggtttgtataaagagttgatggctctacgggatttagttgcagaatatcgagaagatccg
cagaaaaattatgccctcaaagaaggaatttgtaaaaagattattgatagtggtttggat
gccgattgtccgtttgaggaggcgaagaagctgggaattgagtttacacccgaaaatatc
ggcatgtttagccaaaatgtttttgatgattacttggtgaagctgtacgaatatttgcag
gttttggaaaatcgactgttttcttctgggttacatgttttgggggcagctccgaatcag
gaggagatgcagtcttatttggatgcttattttggggaggaggaagaagaaaatcaaccg
cagagttacagagtaagcagaggggaggaggaagagagaattaaagatttattaaaacaa
agtacggatgagttgaagaatttgttacggggtttgaatggggaatatattccaccagcg
ccggggggagatttgttacgagatggtgctggtgtgttaccgacgggaagaaatattcat
gctttagatccctacagaatgccttctcctgctgcttacgaaaggggaagagaggttgca
aggaagattattcagcagcatttacaagaaaatggcagctatccggagactgtagctgtg
atgttatggggattggatgctatcaaaactaagggcgaatctttaggaattttattggaa
ttggtaggggcagaacccgtcaaggaaggtacgggaagaattgttcgttacgagttaaaa
cctttagtagaagttgggcatccccggattgatgttttaggaaatctttcgggaattttc
cgcgatagttttgtgaatattattgagttgttggatgatttgtttcaacgtgctgctgat
gtagatgagcctgtagataagaattttattcgcaagcacgctttggagttaaagcaaaaa
ggtgtagagaatacttctgcgagattattttctaatcctgctggtgattttggttctttg
gtaaacgatagagtcgttgatagtaattgggaatctagcgatgagttagccaatacctgg
caaagtcgcaatgtttttagttatggcagacaagataaagggcaagcacgcccggaagtg
ttaaatcaacttttgggaagcaccagtcaaattgtccaagaaattgattcggtagaatac
ggtttaaccgatattcaagaatattacggaaatactggtggtttgaagaaagctgccgaa
aaacaagctgggaagaaggtgaaagctagctttgtagaaagtttttctaaggatactacc
ccccgctatttagatgatttattgcgaatggaatatcgtactaagttgctaaatcccaaa
tgggctgaagcgatggtaaatcaaggtagcggtggtgcctttgaagtctcgcaacgcatg
acagctttgattggttggggtggtactgcggattttactgatgaatgggtatacgagcaa
gcagcagatacttatgctttggatgccgagatggcggaaaagttgaggaaagcgaatcca
gaagcttttaagaacattgtaggaagaatgctggaagcccacggaaggggcttttgggat
gctagcgacgagaagttgcagaaactacgggagttatatgagttaaccgatgagcaatta
gaaggagttacggtttaa

DBGET integrated database retrieval system