KEGG   Rivularia sp. PCC 7116: Riv7116_4408Help
Entry
Riv7116_4408      CDS       T02364                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00030  Pentose phosphate pathway
riv01100  Metabolic pathways
riv01120  Microbial metabolism in diverse environments
riv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Riv7116_4408
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Riv7116_4408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AFY56829
UniProt: K9RHQ5
Position
5515550..5516365
Genome map
AA seq 271 aa AA seqDB search
MKGISGKNVLVTGATSGIGQSIAVRFAQEGANVAINYRKSPEDAEDTEKLIYKACTDARC
GCDGKEILVQADVSKESDILEMFAEVKKEFGGLDILINNAGIQIAGEAHKIEFEEFEKVI
DVNLKGAYLCAREAIKMFLDGGKGGSIINVSSVHQIIPRPQYISYSVSKGGMQNLTRTLA
LEYARRGIRVNAIAPGATITPINDAWTDDPDKKANVESHIPMGRAGTSEEMAAVTTFLCS
DEAAYITGQTLYIDGGLTLYPDFLEPWSGQG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcataagcggaaaaaacgttctggttacgggtgcaacttctggaataggtcag
tcaattgcggtcagatttgctcaagaaggcgcgaatgtggcaattaactatcgaaaaagc
cctgaggatgccgaagataccgaaaaattgatttataaagcctgtaccgatgcccgttgc
ggttgcgatggtaaagaaatactggtacaagcagatgtatcaaaagaatctgatatttta
gaaatgtttgccgaagttaaaaaggagtttggcggacttgatattttaattaataatgca
ggaattcaaatagctggtgaagcacataaaattgaatttgaagaatttgaaaaagtaatt
gacgttaatttaaagggtgcttacttatgcgctcgcgaagcaattaaaatgtttcttgat
ggaggtaaaggtggaagcattattaatgtttctagcgttcaccaaattattcccagacct
caatatataagttattcagttagtaagggtgggatgcaaaatcttacccgtactttagct
ttagaatatgctagaagagggattcgagtcaatgcgatcgcgcccggtgccactatcacc
cccattaacgatgcttggacggacgatccagacaagaaggctaatgtagaaagtcatata
ccaatgggtagagcgggtacttccgaagaaatggctgccgtcacaacttttctatgttcc
gatgaagcagcttacatcaccggacaaacgctatatattgacggtggattaacgctttat
cccgactttctcgaaccttggtctggacaaggttag

DBGET integrated database retrieval system