KEGG   Rivularia sp. PCC 7116: Riv7116_4415Help
Entry
Riv7116_4415      CDS       T02364                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00220  Arginine biosynthesis
riv00250  Alanine, aspartate and glutamate metabolism
riv00471  D-Glutamine and D-glutamate metabolism
riv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Riv7116_4415
   00220 Arginine biosynthesis
    Riv7116_4415
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Riv7116_4415
Enzymes [BR:riv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Riv7116_4415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFY56836
UniProt: K9RH69
Position
complement(5523384..5524391)
Genome map
AA seq 335 aa AA seqDB search
MSDLPEFIKHLYEKYRDFDNGSLASYIPELTKANPNWFAISIVTKEGEIFEVGDIREHFT
IQSISKVFVYGMALEDCDRETLLEKIGVEPTGDPFNSVIRLDENSKRPDNPMVNAGAIAT
AGLIQGANGTEKLNRLLAMFRRYIGHDVFIDAPVFMSERATGHRNRALANLLLNFGIIEN
NIDEILDLYFQQCSLVVNCHDLAVMAATLANRGINPITNKQAVKSCYVRDILSVMHTCGM
YNYAGEWAYRVGIPAKSGVSGGIIGVIPDKAGIAVFSPLIDNRGNSVRGIKVFEDLSDEF
DLHLFDSPLEKCSFLEISKNKKDVIPGLINDGLKV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacttgccagaattcatcaagcatctctatgaaaaatatcgcgattttgataat
ggttctttggctagctatattcccgagttaacaaaagccaatcccaattggtttgcaatc
tccattgtcactaaggaaggggagatttttgaagttggagacatccgagagcattttacg
attcagtctatatctaaagtttttgtttacggcatggcattagaagactgcgatcgcgaa
acactgttagaaaaaatcggggtagaacctacgggggaccccttcaattctgtgattcgc
ttggatgaaaattctaaacgcccagataatccgatggttaatgctggagcaattgccact
gctggtttaattcaaggtgctaatggtacggaaaagctgaatcgattattagcaatgttc
cgtcgctatatcggacatgatgtatttattgatgctcctgtatttatgtccgaacgagct
accgggcaccgcaaccgcgctttagcaaatttactgcttaattttggcataattgaaaat
aatattgatgaaattttagacctatattttcaacaatgttctttagttgttaactgtcac
gatttagcagtgatggctgcaactttagcaaatcgaggcattaatcctataacgaataaa
caagcagtaaaatcctgttatgtcagagatattttaagcgttatgcatacttgtggcatg
tataactatgctggtgaatgggcttatcgggtgggaattccggcaaaaagtggagtgtcg
ggaggaataattggtgtaattccagataaggctggtattgcagttttttctccgttaatt
gataacagaggtaatagcgtcagaggtattaaagtatttgaagatttatctgatgaattc
gacctgcatttatttgattcgcctttagaaaaatgttcttttctagagatttctaaaaat
aaaaaagatgttatacctggattgattaatgacggtttgaaggtttaa

DBGET integrated database retrieval system