KEGG   Rivularia sp. PCC 7116: Riv7116_5525Help
Entry
Riv7116_5525      CDS       T02364                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:riv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Riv7116_5525
DNA repair and recombination proteins [BR:riv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Riv7116_5525
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Riv7116_5525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_3 HHH_8 IMS_HHH Cdd1
Motif
Other DBs
NCBI-ProteinID: AFY57894
UniProt: K9RKW0
Position
6945838..6946551
Genome map
AA seq 237 aa AA seqDB search
MVEFFWISFPFHLKLIKLTNLKFSKNVIIYRYAHTGDKKTVYARPLARLIEQLQRLPGVG
PKTAQRLALHILKRPEAEIEALAQALIDAKKRVGLCRECFHLSSEAVCEICRNPKRDNET
ICVVADSRDVIALEKTREYKGKYHVLGGVISPIEGIGPEQLNIQPLVRRISQRKPKEVIL
AISPSVEGETTTLYIGQLIKPFTKVTRIAFGLPVGGDLEYADEVTLARALEGRRELD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttggtagaatttttttggatatcattcccctttcaccttaaattaatcaaactaaccaat
ctaaaattctctaagaatgtcattatatataggtacgcacatactggagataagaaaacg
gtttacgcacgtcctttagcacgattaatcgagcaactgcaacgcttacccggagttgga
cccaaaaccgctcaaagattagcgctgcacatcttgaaacgacctgaagccgaaatagaa
gctttagcacaggctttaattgatgccaaaaaacgagtcggcttgtgtcgagaatgcttt
catttatcttccgaagccgtttgtgaaatctgccgcaatcccaagcgcgacaatgaaact
atatgtgttgtagcagattcccgcgatgtgattgctttagaaaaaaccagggaatacaaa
ggtaaatatcatgttcttggaggagtgatttctcctatagaaggtattggccccgaacag
ttaaatattcaacctttagtacgacgaataagtcaaagaaaacctaaagaagttattcta
gcaatcagccctagtgttgaaggtgaaaccactacattatatataggacaattaattaag
ccattcaccaaggtaacgcgaatcgcctttggtttacccgtaggcggtgacttagagtat
gctgacgaagttacattggcaagggctttagaaggtcgccgggaattagattaa

DBGET integrated database retrieval system