KEGG   Roseburia intestinalis XB6B4: RO1_10760Help
Entry
RO1_10760         CDS       T02597                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
rix00260  Glycine, serine and threonine metabolism
rix01100  Metabolic pathways
rix01110  Biosynthesis of secondary metabolites
rix01120  Microbial metabolism in diverse environments
rix01130  Biosynthesis of antibiotics
rix01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rix00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RO1_10760
Enzymes [BR:rix01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RO1_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: CBL11731
UniProt: D4KWJ1
Position
1084022..1085071
Genome map
AA seq 349 aa AA seqDB search
MEKIMIRFNSDYTEGCHPAILRRLEETNMEQTAGYGEDEYCREAAERIKAVCEAPDANVH
FLVGGTQTNVTVIASALRPYQGAITATTGHINVHETGAVEACGYKCLTVDTPDGKLTAEQ
VEKYTKAHFADESFEHMVQPKLVYISNPTELGTIYKKAELEALYRVCRENDLYLFLDGAR
LGYGLACRENDLTMADIAANTDVFYIGGTKVGALFGEAVVITNPELKKDFRYSIKQRGGM
LAKGRLLGIQFLTLFEENRYFEISAHAARLAEKLKDELTKMNISFYINSPTNQQFPILPD
DVLDKLREKYSFAYQARVDETHSAVRFCTCWATKEENVEALLADIRAII
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaataatgatacgatttaacagcgattatacggaaggatgccatccggcaatt
ttaagaagactcgaagagacaaacatggaacagacagcgggatatggagaggatgaatat
tgcagggaggcggcagaacggataaaagctgtctgcgaagcaccggatgccaatgtacat
tttctggttggggggacacagaccaatgtcacagtgatcgcatctgcattaagaccctat
cagggagccatcacggcgacgaccggacatatcaatgtgcacgagaccggggcagttgag
gcgtgcggatataaatgcctgacggtcgatacgccggatggcaagctgacggcagagcag
gttgaaaaatatacaaaagcacattttgctgatgagagttttgaacatatggtacagccg
aaactcgtgtatatttccaatccgacggaacttggaaccatctataaaaaggcagaactt
gaggcgttataccgggtttgcagggaaaacgatctgtatctgtttttagacggagcgaga
cttggatatggacttgcatgccgggaaaatgatctgacgatggcagatattgctgcgaat
acggatgttttttatatcggaggaaccaaggtaggtgctttgtttggtgaggcagtcgtg
atcaccaatcctgaactgaaaaaagatttccgttatagcatcaagcagcgtggcggtatg
ctggcaaaaggaagattgttaggaattcagtttctgactttatttgaggagaaccgttat
tttgaaatatcagcacatgcagcacgacttgcagaaaaattaaaagatgaattaacaaaa
atgaacatttcgttctatatcaattccccgacaaaccagcagttcccgattttgccggat
gatgtattagacaagctgcgggaaaaatacagctttgcatatcaggcaagggtggatgaa
acacacagtgcagtgcgtttctgtacctgctgggcaacaaaagaagaaaatgttgaagca
cttcttgcagacataagagcaatcatatag

DBGET integrated database retrieval system