KEGG   Roseburia intestinalis XB6B4: RO1_22690Help
Entry
RO1_22690         CDS       T02597                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
rix00430  Taurine and hypotaurine metabolism
rix00620  Pyruvate metabolism
rix00640  Propanoate metabolism
rix00680  Methane metabolism
rix01100  Metabolic pathways
rix01120  Microbial metabolism in diverse environments
rix01200  Carbon metabolism
Module
rix_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:rix00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RO1_22690
   00640 Propanoate metabolism
    RO1_22690
  09102 Energy metabolism
   00680 Methane metabolism
    RO1_22690
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RO1_22690
Enzymes [BR:rix01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     RO1_22690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CBL12774
UniProt: D4KZI4
Position
2300270..2301460
Genome map
AA seq 396 aa AA seqDB search
MNVLVVNCGSSSLKYQLIDSDSEAVLAKGLCERIGIDGRLVYQKTGLDKEITEAAMPTHK
QAIQMVLDALVNEKTGAIKSLSEIDAVGHRVVHGGEKFASSIVLTPEVLKAIEECNDLAP
LHNPANLIGIDACKELMPDVPMVGVFDTAFHQTMPKKAFLYGLPYEYYEKYKVRRYGFHG
TSHSFVSKRTAEFLGMDLKNSKIIVAHLGNGASISAVLNGECVDTSMGLTPLEGLVMGTR
SGDIDPAIMEFIAKKENLDIEGVMNVLNKKSGVQGLSKLSSDFRDLEAAANEGNELAIGA
IDVFCYRVAKYIGAYVAAMNGVDAIAFTAGIGENTTIVRAKVLEYLGYLGITVDAQANEV
HGEEKVISTADSKVKVCVIPTNEELAIARETVALVK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttagtagtaaactgcggaagttcttcactgaaatatcagctcatcgattct
gacagtgaagcagtattagcaaaaggactttgcgagagaatcggtattgacggaagactg
gtataccagaagaccggattagacaaagagatcacagaagcagcaatgccgacgcacaaa
caggcaatccagatggtacttgatgcactggtaaatgagaaaacaggtgcaatcaagagt
ctttccgagatcgatgcagttggtcaccgtgttgtacatggtggagagaagtttgcttct
tctatcgttttaacaccggaagtattaaaagcaatcgaagagtgcaatgaccttgcacca
cttcacaacccggcaaacctgatcggtatcgatgcatgtaaagaactgatgccagacgta
ccgatggtaggtgtatttgatacagcattccatcagacaatgccaaagaaagcattcctt
tatggtcttccatacgaatactatgaaaagtacaaagtaagaagatatggcttccatgga
accagccacagttttgtatcaaaacgtactgctgaattccttggaatggatctgaaaaat
tctaagatcattgtggctcatcttggaaatggtgcttctatcagtgccgtattaaatggt
gagtgtgtagatacatccatgggtcttacacctttagagggacttgttatgggaacacgt
tccggcgatattgatccggcaatcatggagttcattgcaaagaaagagaacttagatatc
gaaggtgtcatgaatgttttgaataaaaagtcaggtgtacagggattatcaaaattatca
agtgatttccgtgatcttgaggctgcagccaatgaaggaaatgagcttgcaatcggtgct
atcgacgtattctgctaccgtgttgcaaaatatatcggtgcatatgtggcagcaatgaat
ggtgtggatgcgattgcatttactgcaggtatcggagaaaatacaacgatcgtcagagca
aaggtacttgagtatcttggatatcttggaattacagtagatgcacaggcaaacgaagta
cacggagaggaaaaagtgatctccacagcagattccaaagtaaaagtctgtgtgatcccg
accaacgaggagcttgcaatcgcaagagagacggttgcacttgtaaaatag

DBGET integrated database retrieval system