KEGG   Roseburia intestinalis XB6B4: RO1_41520Help
Entry
RO1_41520         CDS       T02597                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
rix00860  Porphyrin and chlorophyll metabolism
rix01100  Metabolic pathways
rix01110  Biosynthesis of secondary metabolites
rix01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rix00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RO1_41520
Enzymes [BR:rix01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     RO1_41520
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RO1_41520
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     RO1_41520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Radical_SAM Sirohm_synth_M 2-Hacid_dh_C Pyr_redox Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CBL14329
UniProt: D4L3Y9
Position
4114181..4115551
Genome map
AA seq 456 aa AA seqDB search
MAYFPFFIDIENKKGLIVGGGRIAAHKAEKVKPFGAKITIIAPDIMDKLKQDPAFMCEER
PFVPEDIEGCAFVIAATDDRELNHRISALCQEKGILVNVVDDKDYCGFLFPSLVKEGKLT
AGISTAGASPQIAAELRSRMARELPNQMEEILDYLESIREPAKKMIADDRIRARFLKETA
QLCMDENRVPDEGETRQRIRDYCQSAEQTGLGKIVSTGMVTLVGAGCGAYDLITLRGLNA
IRRAEVLVYDDLIDARLLDHASESCEKIYVGKRIGVHSREQEEINAILIEHAKKGKRVVR
LKGGDPFVFGRGSEEMEALKAKGIPVTEVPGITSAIAVPAAAGIPVTHRGKSRSFHVVTA
HTKGTADSLPEGLKELVAVEGTLVFLMGMHQLSKLAGRLMEYGKSPETPAAVVQGNFDGK
TVSVRGTLFDIAEKVKESGMQSPAVIVIGETAEMEL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcatattttccgttttttattgatatagaaaataaaaaaggcctgatcgtgggtggc
ggcaggattgcagcacacaaggcagaaaaggtgaagccgttcggtgcaaagattaccata
atagcaccggatattatggacaaattaaaacaggatccggcatttatgtgtgaggagcgt
ccctttgtgccggaggatatcgagggctgtgcatttgtcattgcagcaaccgatgatagg
gaattaaaccacaggatcagcgcactgtgtcaggaaaaaggaattttagtcaatgtggtg
gatgacaaagattactgcggttttctatttccgtctcttgtgaaagaaggaaaactgacc
gcgggaatctccaccgcaggagccagtccgcagatcgcggcagaattaagaagccgcatg
gcgagggaacttccaaatcagatggaagagatccttgattatttagaatcaatccgggaa
cctgcaaaaaaaatgattgcagatgacaggatcagagccagatttttgaaagagacagca
cagctttgcatggatgaaaaccgcgtgccggatgagggagagacgaggcagcggatcaga
gattattgccagagtgcggaacagactggattagggaaaatcgtcagtacaggcatggta
acgctcgtcggtgcgggctgcggtgcatatgacctgatcacactgcgcggtttaaatgca
atacggagagccgaggtgcttgtctatgacgatctgatcgatgcgcgtctgttagatcac
gcttcggagagctgtgaaaaaatttatgtcgggaaacggatcggtgtacatagcagggaa
caggaagaaatcaatgcgattctgatcgaacatgcgaagaaaggcaaacgcgtggtgcgc
ttaaaaggcggagatccgtttgttttcggcagaggcagtgaggaaatggaagcgttaaag
gcgaaaggaatcccggtgacagaagtgccgggaatcacatctgccattgcggttccggcg
gcagcaggaatcccggtaacacaccgtggaaaaagccgcagttttcatgtggtgacggca
catacgaaaggcactgcggacagtctgccggaaggactaaaagaacttgtggcagtggag
ggcacgcttgtatttctgatgggaatgcaccagctttcaaaactggccggacggctgatg
gagtatggaaaatctccggaaacaccggcagcagtggtgcagggaaattttgatggaaaa
acggtaagtgtgcgaggaacactttttgatattgcagaaaaagtaaaagaatccggaatg
cagtccccggcggtcattgtgatcggggagacggcagagatggagttgtaa

DBGET integrated database retrieval system