KEGG   Rickettsia japonica: RJP_0268Help
Entry
RJP_0268          CDS       T01637                                 

Gene name
cycM
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rja  Rickettsia japonica
Pathway
rja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RJP_0268 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Senescence_reg SDF CbtB
Motif
Other DBs
NCBI-ProteinID: BAK96486
UniProt: G4KMH8
Position
complement(345558..346085)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILLASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGDVWDDDSLFAFLHKPSIYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttattggctagtttaattgct
atgatggttggatttgttgcaaatatattatacaaacccactctagagttacaacatcgc
ggctacagtgttgcggttcaagaatcatcagaaaatcaaaatactactgcactagagcaa
gcaccggtaaatataccagaattaatgaagactgctaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattcccct
gctctatcaaaacttggcgacgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtatctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system