KEGG   Rickettsia japonica: RJP_0837Help
Entry
RJP_0837          CDS       T01637                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rja  Rickettsia japonica
Pathway
rja00071  Fatty acid degradation
rja00072  Synthesis and degradation of ketone bodies
rja00280  Valine, leucine and isoleucine degradation
rja00310  Lysine degradation
rja00362  Benzoate degradation
rja00380  Tryptophan metabolism
rja00620  Pyruvate metabolism
rja00630  Glyoxylate and dicarboxylate metabolism
rja00640  Propanoate metabolism
rja00650  Butanoate metabolism
rja00900  Terpenoid backbone biosynthesis
rja01100  Metabolic pathways
rja01110  Biosynthesis of secondary metabolites
rja01120  Microbial metabolism in diverse environments
rja01130  Biosynthesis of antibiotics
rja01200  Carbon metabolism
rja01212  Fatty acid metabolism
rja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RJP_0837
   00630 Glyoxylate and dicarboxylate metabolism
    RJP_0837
   00640 Propanoate metabolism
    RJP_0837
   00650 Butanoate metabolism
    RJP_0837
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RJP_0837
   00072 Synthesis and degradation of ketone bodies
    RJP_0837
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RJP_0837
   00310 Lysine degradation
    RJP_0837
   00380 Tryptophan metabolism
    RJP_0837
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RJP_0837
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RJP_0837
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RJP_0837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rja04147]
    RJP_0837
Enzymes [BR:rja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RJP_0837
Exosome [BR:rja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RJP_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAK97031
UniProt: G4KLD9
Position
complement(1063162..1064340)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFIGSLSTTAAPMLAAHLIKDILQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIYAGIPKEVPGYTINKVCGSGLKSVALAANSIMTGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDTSLEILSKLRPAFDKNGV
VTAGNASAINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLIT
LIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttataggt
agccttagtacaacagctgcacctatgcttgctgctcatttaataaaggatatactgcaa
aacagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggc
ggtagcgggcagaatccggcgaggcaaactctgatttatgcgggaataccgaaagaagtg
ccgggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagcacttgcagca
aattcaattatgacgggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattaca
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagctagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgataccagccttgaaattctgagtaaattacgtcctgcttttgataaaaacggtgta
gttacagcgggtaatgcttccgctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaagtattatgggtactgcccctgttcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatgttaac
ggtggagcaatagcaatcggtcatccgatcggggcaagcggcggacgtgtactgattact
ctgatacacggcttacgaagagctaaagctaaaaaaggcttagttactttatgtatcggt
ggcggtatgggtatggctatgtgtgttgaagcggtttaa

DBGET integrated database retrieval system