KEGG   Rhizobium jaguaris: CCGE525_01865Help
Entry
CCGE525_01865     CDS       T05891                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00730  Thiamine metabolism
rjg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CCGE525_01865 (tenA)
Enzymes [BR:rjg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     CCGE525_01865 (tenA)
Transcription factors [BR:rjg03000]
 Prokaryotic type
  Other transcription factors
   Others
    CCGE525_01865 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AYG57701
UniProt: A0A387FP33
Position
complement(387727..388425)
Genome map
AA seq 232 aa AA seqDB search
MDGITQGTETTESFTAAAWGQIKPIMAEIERLPLLERLSDGTLPPEVFRHYILQDAIYLK
HYARCLAIVAAKAPDNAQVLRFLGSAQKAITVEQGLHAGFLTQFGISSADVTAAEPSPAC
FAYTNFLLATAYHSSYAVALSAILPCFWIYWHVGEGIKSKPAIEGNVFQAWINTYGDPQF
AAGAREVIALTDIAARAASAPERQLMGDAFARAAQYEWMFWDSAWRLEKWPV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggacggcatcacgcagggcaccgagacgacggaaagcttcacggctgccgcctggggc
cagattaaaccgattatggccgagatcgagcgattgccgctgctggaacgactttcggac
ggcacgctgccgcctgaggttttccgccattatatcctgcaggatgcgatctatctgaag
cactatgcccgctgcctcgccatcgtcgctgcaaaggcgcccgacaatgcgcaggtgctg
cgtttcctcggttcggcgcagaaggcgatcacagtcgagcagggcctgcacgctggcttc
ctgacgcagttcggcatttcgagcgcggatgtgacggctgccgagccttcgccggcctgc
ttcgcctatacaaatttccttctggcgaccgcctatcacagctcctacgccgttgcgctt
tcggcgatcctgccgtgcttctggatctactggcatgtcggcgaaggtatcaaaagcaag
ccggcgatcgagggcaatgtcttccaggcctggatcaatacctatggcgatccgcaattc
gcggccggcgcccgggaagtcatcgctttgactgacatcgcagcccgggcagcctcggcg
ccagagcgccagctgatgggggacgcctttgcgcgtgccgcccaatatgaatggatgttc
tgggattcagcctggcggctggagaagtggccggtctga

DBGET integrated database retrieval system