KEGG   Rhizobium jaguaris: CCGE525_02335Help
Entry
CCGE525_02335     CDS       T05891                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00903  Limonene and pinene degradation
rjg00930  Caprolactam degradation
rjg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCGE525_02335
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CCGE525_02335
Enzymes [BR:rjg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CCGE525_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 DLH
Motif
Other DBs
NCBI-ProteinID: AYG57775
UniProt: A0A387FKK3
Position
477993..478925
Genome map
AA seq 310 aa AA seqDB search
MNSKQSLANKIHYETLAEAWRSGRESPQDASEWSVLTTEPGGVDYVETNLGDKTALWVQP
KLAAKDRVMLYLHGGGYVGGSIWTHRKMVGHLAKAIGCYALLATYDYAVQSKFPRQIEQV
VNAFEWLVEQGIATDHTIGAGDSAGAGLIVAAAIKLRDAGRPLPAALLSISGWHDLSASG
ASYETNRAKDAFFQKASVDMLASLVLGEADARNPFASPIFADLTGLPPINLQVGGDETLL
DDSRVLADRAKAAGVEVRLDVFPGMLHSFQMMAGRAPEADEAIERFAQWVRPKLGLTGTA
STRGESQVVA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaagcagagcttggcaaacaagatacactacgaaacgctcgcggaggcttgg
cgcagcggtcgggaatcaccgcaggacgcctccgagtggtctgttttgacgacagaaccg
ggcggcgtcgattacgtcgagacgaacctcggcgacaagaccgcgctgtgggttcagcca
aaactggcggccaaagatcgggtcatgctttacctgcacggcggtggctatgttggcgga
tcgatctggacccatcgcaagatggtcggacaccttgccaaggcgattggctgttacgct
ctgctcgccacttacgactacgcggttcagagcaagttccctcgccagatcgagcaggtc
gtgaacgcgttcgagtggctggttgagcagggcatcgcgacggatcatacaattggcgca
ggcgattctgctggcgcgggcctgattgttgcggcggcgatcaaactccgcgatgcggga
cgtccgctgccagctgcgctcctcagtatttccggctggcatgatctgtcggcgagtggg
gcctcctacgaaactaaccgcgcgaaggatgccttcttccagaaggcgtcggtagatatg
ctggcatcgctggttctcggagaggccgatgcccgaaatccattcgcgagcccgatcttc
gccgatctcacgggcctgccgccgatcaatctgcaagtgggcggagacgaaacgctgctc
gacgacagccgggtgctcgccgaccgcgcgaaggccgccggcgtcgaggtgcgcctagac
gtgtttccggggatgctgcattcgttccagatgatggctggtcgtgcgcctgaagccgat
gaggcgatcgagcggtttgcacagtgggtccggccgaagctcggcctgaccggaaccgcg
tcaacccgcggtgaaagtcaggtagtcgcatga

DBGET integrated database retrieval system