KEGG   Rhizobium jaguaris: CCGE525_09990Help
Entry
CCGE525_09990     CDS       T05891                                 

Gene name
cobA
Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00860  Porphyrin and chlorophyll metabolism
rjg01100  Metabolic pathways
rjg01110  Biosynthesis of secondary metabolites
rjg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCGE525_09990 (cobA)
Enzymes [BR:rjg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     CCGE525_09990 (cobA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CCGE525_09990 (cobA)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     CCGE525_09990 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M BSD Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AYG59089
UniProt: A0A387FL07
Position
2031544..2032980
Genome map
AA seq 478 aa AA seqDB search
MPPKTDKLSVFPAFFRMEGRTAAVFGNGDEAFAKTRLLMNTQAKIVAYTQTPEADYHSFL
IANRIETVRAAFSPDQVKGAALVFAATGDAEADRAIVDAARAERIPANAVDQPDYCDFYT
PALVNRAPVAVAIGTEGAGPVLAQMIRAQIDQLLSPSLGKLAELATSYRKSVDRLVPRGV
ARRVFWRRFFSGPVADAVSAGHLPQAERAADSLLHSMHKVEGHVWLVGAGPGAEDLLTLR
AQRVMMEADVVVYDALVPQAIVDMGRRDAERLSVGKRKGCHTKSQEEINDLLVQLGQDGK
RVVRLKSGDPLVYGRAGEEMAALRAAGVTYEIVPGITSAFAAAADFELPLTLRGVASSLV
FTTGHDLTGDVLPDWASLALSGATIAVYMGRTVAASVAGRLMNAGLPAETTVAVIENASR
RDRRLMHGTLKDLPDLEHRDELNGPVMVIIGDAVAGANFEQSEPLVRQETAAQEFARS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagactgacaagctttcggtgtttcccgccttctttcgtatggagggacgg
acggcggctgttttcggcaatggtgatgaagccttcgccaagacgcggctgctgatgaac
acgcaggcgaagatcgtcgcctacacgcaaacgccggaagccgactatcattccttcctg
atcgccaaccgcatcgaaaccgtgcgcgctgccttttcgccggatcaggtcaagggcgct
gctctggtattcgccgccaccggcgatgccgaagccgaccgcgccattgtcgatgctgct
cgcgccgaaagaattccggcgaacgctgtcgatcagccggactattgcgatttctacact
ccggcgctcgtcaaccgcgcccccgttgctgttgccatcggtaccgagggcgcaggccct
gtgctggcgcagatgatccgggcgcagatcgaccagctgctgtcgccctcgctcggcaaa
ctcgcggagctggcgacgagctatcgcaaatccgtcgatcgcctcgttccgcgcggcgtc
gctcgccgcgtcttctggcgtcgcttcttttccggccccgtcgccgacgccgtcagtgca
ggtcatttgccccaggccgaacgcgccgccgacagcttgctgcactcgatgcacaaggtt
gaaggccatgtgtggctggtgggcgccggtccgggcgcggaggatctgctgacgttgcgc
gctcagcgcgtgatgatggaagccgatgtcgtcgtctatgacgcgctcgtgccgcaggcg
atcgtcgacatgggccgccgcgatgccgagcgtctttctgtcggcaaacgcaagggctgc
cacaccaaatcgcaggaagagatcaacgatctgctggtgcagcttggccaagacggtaaa
cgcgtcgtgcggttgaagtctggcgatccgctggtttatggcagggcaggcgaagagatg
gctgccctgcgtgccgccggcgtgacctatgagatcgttccgggcatcacgtccgccttt
gccgcggctgccgatttcgagcttccgttgacgctgcgcggcgtcgcctcatcgctggtc
ttcaccaccggtcacgacctgaccggcgacgtcctgccggactgggcgagcctcgcctta
tccggcgcgaccattgccgtctacatgggccgcacggtcgccgcttccgttgccggccgc
ttgatgaacgccgggcttcctgccgagacgaccgtcgccgtcatcgagaacgccagccgc
cgcgatcgccgcctgatgcacggcacattgaaggatctgcctgacctggagcatcgcgat
gagctgaacggcccggtcatggtcatcatcggcgatgcggtcgccggcgccaatttcgaa
cagtccgagccgctggtccgtcaggagaccgccgctcaagaatttgcaaggagctga

DBGET integrated database retrieval system