KEGG   Rhizobium jaguaris: CCGE525_33525Help
Entry
CCGE525_33525     CDS       T05891                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00020  Citrate cycle (TCA cycle)
rjg00620  Pyruvate metabolism
rjg00650  Butanoate metabolism
rjg01100  Metabolic pathways
rjg01110  Biosynthesis of secondary metabolites
rjg01120  Microbial metabolism in diverse environments
rjg01130  Biosynthesis of antibiotics
rjg01200  Carbon metabolism
Module
rjg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rjg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCGE525_33525
   00620 Pyruvate metabolism
    CCGE525_33525
   00650 Butanoate metabolism
    CCGE525_33525
Enzymes [BR:rjg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CCGE525_33525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: AYG63563
UniProt: A0A387FYX2
Position
pRCCGE525c:complement(2458049..2459539)
Genome map
AA seq 496 aa AA seqDB search
MFRERIRNRELLERIVSADDAARLIKDRMTIGMSGFTRAGEAKAVPMALAKRAKDEPLQI
TLMTGASLGNNLDGALVEAHVLARRLPFQSDPVLRNAINAGEVMFIDQHLSETVELLRSR
QIAPVDIAVIEATAITEEGGIIPTTSVGNSASFAILAEKVIVEINQSQPQELEGLHDIYI
PTRRPSREAIPVMAPDSRIGVPFIPILPEKIAAVVVTHNSDSSSTIQPPDAETQAIAGHL
AEFLMHEVKLGRLSRSLLPLQAGIGTIANAVLHGFIDTPFHDLTMYSEVLQDSTFDLIDA
GKLIFASGSSMTLSADKYRKVIPDIVAYKSRLILRPQEISNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVGGTHMMNGIGGSGDFARNAYMSIFVTKSTAKNGAISRVVPMVSHVDHTE
HDVDILVTEIGLADLRGLAPRERATTIIANCVHPTYREALSDYYRRALARGGQTPHLLEE
ALKWHSSLRETGRMLA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcgagcgcataagaaacagggagctgctcgagcgcattgtcagcgcggacgat
gctgcccggctgatcaaggaccgaatgaccatcggcatgagcggttttacgcgcgcgggc
gaggcaaaggctgtgcccatggcacttgcgaaacgcgccaaggacgagccgctgcagatc
acactgatgaccggcgcgtcgctggggaacaatctcgacggggccctggtcgaggcgcat
gtgcttgcccgtcgtctgccttttcagtccgatccggttctgcgaaacgcgatcaatgcc
ggtgaagtcatgttcatcgatcagcatctgtccgagacggtggaacttcttcgcagccgt
cagattgcgccggtcgatattgccgtgatcgaggcgacggccatcaccgaagaaggcggg
atcattccgacaacatcggtcggcaattcggcaagcttcgctattctggcggaaaaggtg
atcgtcgaaatcaatcagtcgcagccacaggaattggaagggctgcacgacatctatatc
ccgacgcgccggccaagccgcgaggcaattcccgtcatggcacccgacagccgcatcggc
gtccctttcatcccgattcttccagagaagatcgcggcggttgttgtcacgcacaacagt
gacagttcttcgaccattcagcctccggacgccgaaacgcaggcgattgccgggcatctg
gcggagttcctgatgcatgaggtcaaactcgggcgcctgagccgaagcctgttgccgctt
caggccggcatcggcacgatcgcaaatgccgtactccatggtttcatcgatacgccgttt
cacgatctgacaatgtattccgaggttcttcaggattcgaccttcgatctgattgacgcc
ggaaagctcatatttgcatccggttcctcaatgaccttgtcggcggacaagtatcgcaag
gtcattccggatatcgtagcgtataagtcgcggctgatcctgcgcccgcaggagatcagc
aatcatccggaagtcattcgtcgcctcgggattatcggtatcaacaccgcgctggagttc
gacatctacggcaatgtcaattcgacccatgtcggtggaacccacatgatgaacggtatc
ggcggttccggcgattttgcccgcaatgcctatatgtccatcttcgtcacgaaatcgacg
gcaaagaacggcgcgatttcaagggtcgtgcccatggtcagccatgtggaccataccgaa
cacgacgtcgacatactggtgacggaaatcgggctggcagaccttcgtggtctcgcgccg
cgtgaacgcgccaccacaatcatcgccaattgtgtgcatccaacctaccgcgaagccttg
tccgattactacagaagagcccttgcacggggcggacagacgccgcacctcctcgaggag
gctctcaaatggcatagttcattgcgcgaaacggggcggatgctggcttag

DBGET integrated database retrieval system