KEGG   Rhodoluna lacicola: Rhola_00003740Help
Entry
Rhola_00003740    CDS       T03203                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
rla  Rhodoluna lacicola
Pathway
rla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rhola_00003740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rla01007]
    Rhola_00003740
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rla03016]
    Rhola_00003740
Enzymes [BR:rla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Rhola_00003740
Amino acid related enzymes [BR:rla01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Rhola_00003740
Transfer RNA biogenesis [BR:rla03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Rhola_00003740
 Prokaryotic Type
    Rhola_00003740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1d tRNA-synt_1f tRNA-synt_1c FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AIC47195
UniProt: A0A060JEM9
Position
382760..384217
Genome map
AA seq 485 aa AA seqDB search
MSLSLFDSKAQAVRAFAPIVPGQVGIYLCGPTVQGAPHVGHLRSALVYDQLRRWLTVRGH
NVTLVRNVTDIDDKVLDNAKQTGQQWWALAYRYELEFNSAYSALGIQAPTYEPRATAAIP
EMIEIIQRLIDNGYAYVADDGSANVYFSAGKWADYGELTNQRITEMESSDDGEQRGKRES
HDFALWKAHKPGEPESASWHTPFGDGKGKGRPGWHIECSAMSTKYLGTKFDIHGGGLDLR
FPHHENELAQSRAAGDEFANYWLHNGLVNVSGQKMSKSLGNSIFASDLLDAGRGIAVRYY
LGSAHYRSVLDYHEGVLDEAESAVSRIETFIDRATRRLAGTKFAAEPVAAAQLLSVLPTE
FVSAMDDDLAIPAALAALHETVRGGNSSLDAEDLPAAANALVEVHAMTEVLGINPQAWQA
AAHSGTTGGAAKDEALETLVVSLIAERDAARAAKDFARSDAIRDQLKAAGIVLEDAADGT
HWSVS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcagcctgtttgattcaaaagcccaagccgtgcgtgcatttgcacccatcgtt
ccaggtcaggttggtatctacctatgcggcccaacggttcagggcgcaccgcacgttggt
caccttcgttctgccttggtttacgaccagcttcgtcgctggctgaccgttcgcggtcac
aacgtaactctggtgcgcaacgtcaccgacattgacgacaaggttctagacaacgccaag
caaacaggtcagcagtggtgggcactggcttaccgatacgagctggaatttaatagcgcg
tactcagcgctgggaattcaggctccaacttatgaaccgcgagcaaccgctgcaattcca
gaaatgattgaaatcattcagcgcctgattgataacggatacgcctatgttgccgacgat
ggttcggcgaatgtttatttttcagccggcaagtgggcagactacggcgagctgaccaat
cagcgaatcaccgagatggaatcatcggacgatggcgagcagcgcggcaagcgcgagtcg
catgattttgctctttggaaagcgcacaagcctggcgaaccagaatctgcttcctggcac
acgccgttcggcgacggcaaaggtaaaggtcgccctggttggcacattgagtgctcagcc
atgtcaacaaaatacttgggcactaagtttgatattcacggcggcgggttagacctaagg
ttcccgcatcacgaaaatgaattggctcagtcccgcgctgccggcgatgaattcgccaac
tactggctgcacaacggcttggtcaatgtttccggtcaaaagatgtcaaagtctttgggc
aactccatttttgccagcgatcttctggatgccggtcgcggcattgcggtgcgctactac
ttgggctcggcgcattaccgcagcgtattggattaccacgagggcgtgcttgacgaagcc
gaatcggcagtatcgcgaattgaaaccttcattgaccgagccacccgccgactggcaggc
acaaagtttgccgccgagccagtggcggcagcgcaactgctatcggtgttgcccactgaa
tttgtcagcgccatggatgacgacctggccataccagcggcgctggctgcactgcacgaa
accgtgcgcggtggtaactccagtttggacgccgaagatcttccagcagcagcgaatgcg
ctggttgaggttcacgcgatgaccgaggtcctgggaatcaatccacaggcttggcaggcg
gccgcgcactctggcacaaccggtggtgctgcgaaagacgaggcgctagaaactttggtg
gttagcttgatcgccgaacgagacgcggcccgtgctgcaaaagactttgcgcgatcagac
gcaattagagatcaacttaaggcagcgggcatcgtgctcgaggatgctgccgacggaacc
cattggagtgttagttaa

DBGET integrated database retrieval system