KEGG   Rhodoluna lacicola: Rhola_00006460Help
Entry
Rhola_00006460    CDS       T03203                                 

Definition
(GenBank) o-succinylbenzoic acid (OSB) synthetase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
rla  Rhodoluna lacicola
Pathway
rla00130  Ubiquinone and other terpenoid-quinone biosynthesis
rla01100  Metabolic pathways
rla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rhola_00006460
Enzymes [BR:rla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     Rhola_00006460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N Enolase_C
Motif
Other DBs
NCBI-ProteinID: AIC47455
UniProt: A0A060JFC5
Position
654023..655138
Genome map
AA seq 371 aa AA seqDB search
MKLEAVELIRLNVPLKSAFRTSFSSVNMHEVVWVHAVTDEGEGWAECGANDRPDYSSEYH
TGAMAVLREFILPDLFKLGNDLSAEAVAPTLHWIKQHRMAKAAIETALLDAQLRASTTSF
AEYFGATRDKVPAGVSVGIMDSLPELMGFVEGYLNEGYVRIKLKIEPGWDYEPVKLVRET
YGPDLLLQVDANTAYTRDDFDLLKRLDEFNLLLIEQPIYEEDLLGHAKLADYIETPVCLD
ETIISADIARDAIELGAAEIINIKPSRVGGYIESVKIHDISVANNIPVWCGGMLETGIGR
AANLALAAMPGFTLPGDTSASSRYFETDLTEPFVLVDGHISVPTGPGIGVDPIPEIIERF
AVSREWIKRPN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttagaggcagttgaacttatccgattgaacgtgccattgaaatcggccttcagg
acttcattcagttctgtgaacatgcatgaggtggtttgggttcacgctgtcaccgatgag
ggtgagggatgggctgagtgcggtgccaacgatcgccctgactactccagcgaatatcac
accggggccatggctgtacttcgcgagttcattcttcccgacctcttcaagctcggcaac
gatctaagtgccgaggccgtagccccgactttgcattggatcaagcagcaccgcatggcg
aaggctgccattgaaacagcattgcttgatgcacagcttcgagcgagcacaacttctttt
gctgagtattttggcgccactcgagacaaggttcctgcgggtgtttcagtgggaattatg
gattctctgcccgagctaatgggcttcgtcgaaggttacctaaatgagggttacgtgcga
atcaaactcaaaattgaacccggctgggactacgagccagtaaaactcgttcgagagact
tacggccctgatttgctacttcaggttgacgcaaataccgcttacacccgagatgatttt
gatttgctcaaacgtcttgatgaattcaatttgctgttaattgagcagccaatttatgaa
gaagatctactgggtcacgcaaagctggccgattacattgagactccggtctgcttggat
gaaacaatcatttctgctgacatcgcacgtgatgcaattgaactgggagccgctgaaatt
attaacatcaagccgtcacgtgttggcggatacatcgaatcggtaaagattcacgatatc
tcagtagccaacaacattccggtctggtgcgggggaatgctggaaactggaattggtcgc
gctgcgaatcttgctcttgccgccatgcctggctttaccttgccgggcgacacctcagca
tcatctcgctattttgaaaccgatttgaccgaaccattcgtactagttgatggccacatt
tctgtgcccacaggtcctggaatcggtgttgatccaattcctgagattattgaaaggttt
gcagtttccagagagtggattaagcgtccaaattag

DBGET integrated database retrieval system