KEGG   Rhodoluna lacicola: Rhola_00007460Help
Entry
Rhola_00007460    CDS       T03203                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
rla  Rhodoluna lacicola
Pathway
rla00770  Pantothenate and CoA biosynthesis
rla01100  Metabolic pathways
Module
rla_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:rla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rhola_00007460
Enzymes [BR:rla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Rhola_00007460
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Rhola_00007460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Nitro_FeMo-Co YjeF_N
Motif
Other DBs
NCBI-ProteinID: AIC47550
UniProt: A0A060JFN9
Position
756292..757491
Genome map
AA seq 399 aa AA seqDB search
MHVIVGITGGIAAYKATAIIRLLTEAGHTVKVIPTQNALRFIGATTLEALSHNTVDPDLY
TDVESVKHVALGQEADLVIVAPASASFLARYSAGIADDLLGNTLLVTKAPLVVAPAMHTE
MWLHPATQANVKLLTERGVHILEPAVGRLTGEDSGIGRLPEPEEIVSFALSKIGRQDLAG
KRFLITAGGTREEIDPVRFIGNKSSGKQGIAIALEAAQRGATVTLIAANIAAVPSEIQNV
IPVQDTQQLSQKLNEQLAEQDVLVMAAAVADFRVANTASNKLKRSELGNHLQLELVANED
ILANAVKRIQAEHLQVVTVGFAAETAADTHQLEELAKSKLAHKGCDLVVANNVANGAVFD
ADTNDVLILTRSGRTVAAQGSKRLVAAELLDVIADLQAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtaatcgttggtattaccggtggcatagctgcctacaaggccacggccattatt
cgattactaacagaggcgggccacaccgtaaaggtgataccaacccaaaacgcgttgcga
tttatcggagccacaacgctggaggcactgtctcataacacggttgaccctgatttgtac
accgatgttgaatccgtgaagcatgttgctcttggtcaggaagccgatttagtaatcgtt
gcacctgccagtgcatcgttcttagccagatacagcgcgggaatcgcagatgacctactc
ggcaacacgttgctggttactaaggctccgttagtagttgcaccagcaatgcacacagaa
atgtggctgcatccggccactcaagcaaacgttaagttgcttaccgaacgtggcgtgcac
attcttgaaccggcagtgggtcgtctgacaggggaagatagcggcattggacgcctaccg
gaacctgaagaaattgtttcgtttgcgctctctaaaattggcaggcaagacctcgccggt
aaaagatttttgatcacagccggaggcaccagagaagaaattgatccagttcgtttcatc
ggcaacaagtcttctggcaaacaggggattgccattgcacttgaagctgcgcaacgcgga
gcaactgtgacactgattgcagccaacatcgcggctgttccaagtgaaattcagaatgtc
attccagtgcaggacacacagcagttaagtcagaagctgaacgagcaactcgccgagcaa
gatgtcttggttatggcggcggcagttgccgactttagggttgcgaatacagcctcaaac
aaactaaaacgttctgagttgggcaatcacttgcagttagaactagtcgccaatgaagat
atactggccaacgctgttaagcggattcaggccgaacacttgcaggttgtcaccgttggc
ttcgcagcggagaccgctgccgacacgcaccaacttgaggaactagctaaatcaaaactt
gcacataagggttgcgacttggtagttgccaacaatgtcgccaatggtgccgttttcgac
gccgacactaacgacgtactgattctcacacgaagcggtagaaccgtggcggctcaaggg
tcaaagcgtttagtagctgcagaactgctagacgtaatagctgacctgcaagccaaatga

DBGET integrated database retrieval system