KEGG   Rhodoluna lacicola: Rhola_00011520Help
Entry
Rhola_00011520    CDS       T03203                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
rla  Rhodoluna lacicola
Pathway
rla00051  Fructose and mannose metabolism
rla00520  Amino sugar and nucleotide sugar metabolism
rla01100  Metabolic pathways
rla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rhola_00011520
   00520 Amino sugar and nucleotide sugar metabolism
    Rhola_00011520
Enzymes [BR:rla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Rhola_00011520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AIC47945
UniProt: A0A060JGT4
Position
complement(1160534..1161652)
Genome map
AA seq 372 aa AA seqDB search
MTTQRDPLDRFFSIIPAGGIGSRLWPLSRASAPKFLHDLTGSGQTLLQDTWDRLTPIAGK
ERILVVTGKVHKSAVLEQIEDLSTDNLVLELSPKDSTAAIALAAAILMNREPDVIVGSFA
ADHVITEDEQFHKTVREAVLVAATGKIVTIGIEPTEPSVGFGYIKSGDELGVTGAPEARH
VIKFVEKPNIAKARKYVDSGQYLWNAGMFIAPAALLLEQLAKSEPALHASIMELAAEWDT
DNRKAAIEKIWPTLKKVAIDYSVAEPAAAAGLVAVIPASFSWHDVGDFAAIAELQSQGRR
GNLAVLGNAKVLADSSSGILVSDTDRLIALIGVEDIIVVDTPDALLVTTKEHAQRVKSLV
DALKATGHSDVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagcgagatccactggatcgattcttcagcatcatccccgccggcggtatc
ggtagccgactctggccactttctcgtgcctcggccccaaagtttttacacgacctaact
ggttcaggtcagaccctgctgcaggacacctgggatcgcttaaccccgatagccggcaag
gaacgaattctcgtggtcaccggcaaagttcacaagtcggccgtgcttgagcagattgaa
gacctctctactgacaacctggtgctggaactttcaccaaaggattccaccgctgcgatc
gcgctcgccgcagccattttgatgaaccgggaaccagatgtgattgttggttcctttgcc
gcagatcacgtaatcacagaagacgagcagttccacaaaaccgtgcgcgaggcagttctc
gttgccgccaccggaaaaatcgtgaccatcggaatcgagcccaccgagccatctgttggt
tttggttatatcaaatccggcgatgagcttggagttaccggtgcgccagaggcccgccac
gtgatcaagttcgttgaaaagccaaacattgccaaggctcgcaagtacgtggactcgggg
cagtacctgtggaacgccggtatgttcatcgctccagccgcgctgctgcttgagcagttg
gctaaatcagagccagcgctacacgcatcaattatggaattagcagccgagtgggacacc
gataaccgcaaggctgcaattgaaaagatttggccaaccctaaagaaggtggctattgat
tactcggtggccgagccagcggcagcagccggcttagttgccgtgattccggccagtttt
tcttggcacgatgtaggtgacttcgcggcgattgcagaattgcagtcacagggtcgtcgc
ggcaaccttgccgtcttaggtaacgccaaggtattggccgatagttcaagcggcatcctg
gtttcggataccgatcgcctgatcgcgctcatcggtgttgaagacatcattgttgtggac
accccggatgcgctgttggtgaccaccaaagagcacgctcagcgagtcaagagtttggtt
gatgcgttgaaggccactggccattccgacgttctctga

DBGET integrated database retrieval system