KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_01300Help
Entry
RLEG3_01300       CDS       T03009                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00071  Fatty acid degradation
rlb00072  Synthesis and degradation of ketone bodies
rlb00280  Valine, leucine and isoleucine degradation
rlb00310  Lysine degradation
rlb00362  Benzoate degradation
rlb00380  Tryptophan metabolism
rlb00620  Pyruvate metabolism
rlb00630  Glyoxylate and dicarboxylate metabolism
rlb00640  Propanoate metabolism
rlb00650  Butanoate metabolism
rlb00900  Terpenoid backbone biosynthesis
rlb01100  Metabolic pathways
rlb01110  Biosynthesis of secondary metabolites
rlb01120  Microbial metabolism in diverse environments
rlb01130  Biosynthesis of antibiotics
rlb01200  Carbon metabolism
rlb01212  Fatty acid metabolism
rlb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLEG3_01300
   00630 Glyoxylate and dicarboxylate metabolism
    RLEG3_01300
   00640 Propanoate metabolism
    RLEG3_01300
   00650 Butanoate metabolism
    RLEG3_01300
  Lipid metabolism
   00071 Fatty acid degradation
    RLEG3_01300
   00072 Synthesis and degradation of ketone bodies
    RLEG3_01300
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLEG3_01300
   00310 Lysine degradation
    RLEG3_01300
   00380 Tryptophan metabolism
    RLEG3_01300
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RLEG3_01300
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RLEG3_01300
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLEG3_01300
Enzymes [BR:rlb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RLEG3_01300
Exosome [BR:rlb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RLEG3_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHF88337
UniProt: W0IV17
Position
unnamed4:complement(8229..9437)
Genome map
AA seq 402 aa AA seqDB search
MVLQDPIVIVGAARTPIGSFQGELKEATAPELGATAIRAALQRSRVEAEAIEEVVFGCVL
PAGQGQAPARQAAIHAGLPFATAASTVNKMCGSGMKAVMMAHDLIAAGSASVAVAGGMES
MTNAPYLLDKARGGYRLGHGRVVDHMFLDGLEDAYDKGRLMGSFAEDCAEAYQFTREAQD
NYAIASMTRAQKAIAEGCFESEIAPVTVKSGKVEQVASRDEQPGKAKLNKIPTLKPAFRD
GGTVTAANSSSISDGAAALVLMRRSEAEHRGLKPLATILGHATHSQAPNLFATAPIGALQ
KLSDRTGMPLSEVDLFEINEAFAVVAMAAMRDLNLPHEKVNVHGGACTLGHPIGASGARI
LVTLLAALERYDLKRGMAALCIGGGEATAVAIERHERGGRDR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggttttgcaggatcccatcgttatcgtcggtgcggcgcgcaccccgatcggcagcttt
cagggagagctgaaggaggcgactgcgccggaactcggagcaaccgcgatccgggcggca
ctgcagcggagccgcgtcgaggccgaggcgatcgaggaggtggtcttcggctgcgtactg
ccggcggggcaggggcaggcgccggcgcgccaggcggcgatccatgccggcctgcccttc
gcgaccgcggccagcaccgtcaacaagatgtgcggctcgggcatgaaggcggtgatgatg
gcacatgacctgatcgccgccggcagcgcctccgtggcggtcgcgggcggcatggaaagc
atgacgaatgcgccctatctcctggacaaggcccgtggcggctacaggctcggccatggg
cgcgtcgtggatcacatgttcctcgacgggctggaggatgcttatgacaaggggcgcttg
atgggcagcttcgcggaggattgcgccgaagcctatcagttcacgcgcgaggcgcaggac
aactacgccatcgcctcgatgacgcgggcgcagaaggcgatcgccgaaggctgtttcgaa
agcgagatcgcgccggttacggtgaaatcgggcaaagtcgagcaggtggcgagccgcgat
gaacaacccggcaaggcgaagcttaacaagatcccgacgctaaaacccgccttccgcgac
ggcggcacggtgaccgccgccaattccagctcgatctccgatggtgcagcagcccttgtg
ctgatgcgccgttccgaagcggagcatcgcggcctgaagccgctggcgacgatcctcggc
catgccacgcattcgcaggcccccaatcttttcgccacggcaccgatcggcgcgctgcag
aagctgtccgatcgcaccggtatgccgctgtcggaggtcgatctgttcgaaatcaacgag
gctttcgccgtcgtcgccatggcggcgatgcgtgatctcaacctgccgcatgaaaaagtg
aatgtgcatggcggcgcctgcacgctcggccatccgatcggcgcctcgggcgcccggatt
ctggtgacgctgctggcagcactggagcgatacgacctgaagcgcggcatggccgcgctc
tgcatcggcggcggcgaggcaaccgcagtcgccatcgagcggcacgagcggggagggcgg
gatagatga

DBGET integrated database retrieval system