KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_02375Help
Entry
RLEG3_02375       CDS       T03009                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RLEG3_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHF88552
UniProt: W0IVS4
Position
unnamed4:complement(225322..226326)
Genome map
AA seq 334 aa AA seqDB search
MDASLALPLLVGLVVIALFFDFLNGLHDAANSIATIVSTRVLRPQYAVAWAAFFNFIAFL
FFGLHVAETLGTGIIDPAIVSPQLIFAALMGAIIWNIITWIFGIPSSSSHALVGGLVGAG
LAKVGFNSIVWNGLLKTVGAIFVSPAIGFLLALVLVLAVSWLFVRQTPFAVDRTFRVMQF
VSASLYSLGHGGNDAQKTMGIIAVLLFSQGYLGPTFYVPFWVVITCQSAMALGTLFGGWR
IVHTMGSKITRLNPMQGFCAETGGALTLFGATWLGIPVSTTHTITGAIVGVGAARRVSAV
RWGLAGNIVIAWIVTMPAAAAISAAFYGLVSLLQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcctccctcgctctgccgctgctggtcggcctagtcgttatcgccttgttcttc
gactttctcaacggtctgcatgacgcggccaattcgatcgccacgatcgtctcgacccgc
gtcctgcggccacaatatgcggtcgcttgggcggcgttcttcaatttcatcgcattcctg
ttcttcggcctgcacgtcgccgaaacactggggaccggcatcatcgatcctgcgatcgtt
tcgcctcaactgatcttcgcagcactcatgggcgcgatcatctggaatatcatcacctgg
attttcgggattccgtcgagctcgtcgcatgcgcttgtcggtgggctggtgggggccggt
ctggcaaaggtgggcttcaactcgatcgtctggaacggccttctaaaaaccgtcggtgca
attttcgtgtcgccagccatcggctttctacttgccctggtgctggtgctcgccgtctcc
tggttattcgtccggcaaacgccgtttgcggtggatcgcacatttcgcgtcatgcaattc
gtgtccgcttcgctctattcgcttggccacggcggaaacgatgcgcagaagacgatgggc
atcatcgcggtgctcttgttcagtcagggatatcttggcccgaccttctacgtgcctttc
tgggtggtcattacctgccagtcggcaatggctctcgggacgctctttggcggatggcgg
atcgttcataccatggggtcgaagatcacccgactcaaccccatgcaaggtttctgcgca
gagacaggcggagcgttgacactcttcggagcaacgtggctcggtattcccgtttcgacg
acgcataccatcaccggagcaatcgtcggagtgggcgcggctcgtcgtgtctcagccgtg
cgctggggattggccggcaacatagtgatagcctggatcgtcacgatgccggcggctgca
gcaatatccgcagcgttctacggcctcgtatccttgctgcaatga

DBGET integrated database retrieval system