KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_03245Help
Entry
RLEG3_03245       CDS       T03009                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RLEG3_03245
Enzymes [BR:rlb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RLEG3_03245
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RLEG3_03245
    1.1.1.-  
     RLEG3_03245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AHF88117
UniProt: W0IUE6
Position
unnamed3:134444..135478
Genome map
AA seq 344 aa AA seqDB search
MEEAADPASPQFGQVIVEPTFCGICGTDLHEFESGPIFTPKTPNAYSGAILPQILGHEFA
ARVVSIGPGVETLKPGDRVSIQPQIGPRLGYFGTRNLSFLGPQASVVGLSWPWGGMAKRA
IVHEYNAIRMPDDVTDQQGALVEPAAVAVHAIDRSGLTPGGTLLITGAGPIGALVVLAAV
AAGVTRIFVSEPNANRRARIAALSKDVTMLDPGSPDFMSTIRDGTEEGVGVDAAIECAGH
PRALQTCLQAVRAQGTVVQVGLMGGPTEISPFELTMRDITLRGSLNYPLTIWPRIFEMMR
TGLYPAEKIVDDEIAMDDVVDKGFRELLDPNGGKMKILVSMQSA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaggctgccgatcccgcgtcaccccagtttggccaggtcatcgtagagccgacg
ttttgtggcatctgcgggaccgatctgcacgagttcgaatccggtccgatcttcactccc
aagacgcccaacgcctatagcggcgccatcctccctcaaatcctcggccacgaattcgcg
gcgcgagtcgtctcgatcggccctggtgtggagactctgaagcccggagaccgcgtgtcg
atccagccgcagatcggcccaaggctcggctatttcgggacccgcaacctgtcgttcctg
ggacctcaggcttccgtcgtcggtctgagctggccttggggcggcatggcgaagcgcgcc
atcgtccacgaatacaacgcgatccgcatgcctgacgacgtgacggaccagcaaggcgcg
ctcgtcgagccggcggcggtagccgtccatgccattgaccgatcagggctgacgcctggg
ggtacccttcttataaccggcgcgggtccgatcggcgcgctggtggtcctcgcggctgtc
gccgcaggtgtgacgcggattttcgtcagcgagccgaatgccaaccgtcgggcgcgcatc
gcggcgctttcgaaggacgtcacgatgctcgatcctggttccccggacttcatgtccacg
atcagggacgggacggaggagggcgtcggagtagacgcggcgattgagtgcgcgggccat
ccccgcgccttgcagacttgccttcaggccgtccgcgcccagggcaccgtcgttcaggtc
ggactaatgggcggccccaccgagatcagtcctttcgagctgacgatgcgggacatcact
ctgcggggatcgctgaattacccgctgaccatctggccccgaattttcgagatgatgagg
accggcctctatccagccgagaagatcgtcgatgacgaaatcgccatggatgacgtcgtc
gacaagggcttccgggaactcctggacccgaacgggggcaaaatgaagatactcgtgtcg
atgcagtccgcctga

DBGET integrated database retrieval system