KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_07375Help
Entry
RLEG3_07375       CDS       T03009                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00071  Fatty acid degradation
rlb00072  Synthesis and degradation of ketone bodies
rlb00280  Valine, leucine and isoleucine degradation
rlb00310  Lysine degradation
rlb00362  Benzoate degradation
rlb00380  Tryptophan metabolism
rlb00620  Pyruvate metabolism
rlb00630  Glyoxylate and dicarboxylate metabolism
rlb00640  Propanoate metabolism
rlb00650  Butanoate metabolism
rlb00900  Terpenoid backbone biosynthesis
rlb01100  Metabolic pathways
rlb01110  Biosynthesis of secondary metabolites
rlb01120  Microbial metabolism in diverse environments
rlb01130  Biosynthesis of antibiotics
rlb01200  Carbon metabolism
rlb01212  Fatty acid metabolism
rlb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RLEG3_07375
   00630 Glyoxylate and dicarboxylate metabolism
    RLEG3_07375
   00640 Propanoate metabolism
    RLEG3_07375
   00650 Butanoate metabolism
    RLEG3_07375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RLEG3_07375
   00072 Synthesis and degradation of ketone bodies
    RLEG3_07375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLEG3_07375
   00310 Lysine degradation
    RLEG3_07375
   00380 Tryptophan metabolism
    RLEG3_07375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RLEG3_07375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RLEG3_07375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RLEG3_07375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rlb04147]
    RLEG3_07375
Enzymes [BR:rlb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RLEG3_07375
Exosome [BR:rlb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RLEG3_07375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHF86961
UniProt: W0IQB2
Position
unnamed:122442..123653
Genome map
AA seq 403 aa AA seqDB search
MILSYAFQPDKDWQPVVVAAYRSPIGRAFGSLATVAAEDLLAPIIHRILSETGIAPQSID
DVLVGNAAGGGGNIARLTALTAGLPMAVPGVSIDRQCGSGLEAIITAARLIQAKAGSCFL
AGGVESVSTAPWRVERPKANGMPPRFYGRARFSPETIGDPEMGIAAENVARQFDISRQRQ
DEFALRSHRLAVAAAEAGIFRPEIVDISTGHGLIERDECPRAATSFQALANLRPVFLADG
SVTAGNACPLNDAACLVLVMSRGMAKSLGFEKGLAFIDSAAAGVDPNLLGIGPVASTRKL
LQRQPRLSLVDIDAIEFNEAFAAQVLASLDQLAIPADAINKDGGAIALGHPFGASGAILV
TRLYSQLIRNTGGSWAPGATAFAMIGIGGGIGLTAMFEAAQLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgtcctacgcctttcagcctgacaaggactggcagccagtcgtggttgccgcc
taccgctcgccgatcggccgggctttcggatcgcttgcgactgtcgcggcagaagacctg
cttgcgccgatcatccatcggatcctgtccgagacgggaattgcgccccaaagcatcgac
gatgtgctggtgggcaatgccgctggcggcggcggaaacatcgcgcgactgacagcgctg
accgcaggcctgccgatggcggttccgggtgtttcgatcgatcggcaatgcggttcgggc
ctggaagcgatcatcacggcagcccggctgatccaggcgaaagccggttcgtgctttctg
gccggcggcgtcgagagcgtcagcacagcgccatggcgcgtcgaaagaccaaaggcgaat
ggcatgccgccgcgattttacgggcgcgcccggttttcgcctgaaacgatcggcgatccg
gaaatgggaattgccgccgaaaacgtcgcccgtcagttcgacatatcgcggcagagacaa
gatgaattcgccctgcgcagccataggctcgccgtagcggcggccgaggcaggcatcttt
cggcccgagatcgttgacatttccaccggccacggtctgatcgaacgggacgaatgccca
cgtgcggctacatccttccaggcgctcgcaaacctccggccggtcttcctggccgatggt
tcggtgacagccggcaatgcctgcccgctgaacgacgccgcctgcctggtgctcgtcatg
agccgtggcatggcgaaaagcctcggcttcgaaaagggccttgccttcatcgacagcgcc
gctgccggcgtagaccccaatctgctcggcatcggcccggtcgcctcgaccaggaagttg
ctgcagcgtcagcccaggctctcacttgtagacatcgatgccatcgaattcaacgaggcc
tttgcggcccaggttctggcatcgctggaccagctcgctatccctgccgacgcgatcaac
aaggacggcggagccattgcgctcggccatccattcggggcctccggcgcaatcctcgtt
acccggctatacagccagttgatccgcaacaccggcggaagttgggcgcccggcgcgact
gcctttgccatgatcggcatcggcggaggcatcgggctgaccgcgatgttcgaggctgcc
cagctttcctga

DBGET integrated database retrieval system