KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_10905Help
Entry
RLEG3_10905       CDS       T03009                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RLEG3_10905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHF82304
UniProt: W0ICT1
Position
complement(185735..186127)
Genome map
AA seq 130 aa AA seqDB search
MYRALTREIEVVVEPFYLEEQSDPEDDRYVWGYRIVISNNSNIAVRLVNRYWNITDQNGQ
VDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQMETDDGEMFDVDIPAFSL
DSPGLLRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcgccctcacaagagagatcgaagtcgtcgtcgagccgttctatctggaggag
caatccgatccggaagacgatcgctatgtctggggttaccggattgtcatcagcaacaat
tccaacatagccgttcggctggtcaaccgttactggaacatcaccgaccagaatggccag
gtggacgaggtgaccggccccggcgtcgtcggcgagcagccgcggctcagccccggcgac
acctacgaatattcctccggctgcccgctcgacacgccctcagggctgatgttcggccat
taccagatggaaacggacgacggcgagatgttcgatgtcgacatccccgccttctcgctg
gattcgcctgggctgctgcgcgtgcttaactga

DBGET integrated database retrieval system