KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_30675Help
Entry
RLEG3_30675       CDS       T03009                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
rlb00220  Arginine biosynthesis
rlb00330  Arginine and proline metabolism
rlb01100  Metabolic pathways
rlb01110  Biosynthesis of secondary metabolites
rlb01130  Biosynthesis of antibiotics
rlb01230  Biosynthesis of amino acids
Module
rlb_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rlb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RLEG3_30675
   00330 Arginine and proline metabolism
    RLEG3_30675
Enzymes [BR:rlb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RLEG3_30675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AHF85918
UniProt: W0IIF1
Position
4095708..4096643
Genome map
AA seq 311 aa AA seqDB search
MNAQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADIGDLRIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAASKDR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIMREILDVVTKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcaatcgcgatctgtcaccctcatcggcgcgccgctggaagaaggctccggc
cgcagaggggctgccatgggccctgcggccctgcgcattgccggcgtcgaccagacgctg
atcgagcttggccatgacgtcgccgatatcggcgatctcaggatcgtgccggcgatggat
ctgccgaaccacccgaaggcccacaatctgaggatcgtcggcgccttcacgcgcgccctc
gaaagcagcgtccacgacgtcgccgcatccggccgtttcccgctcattctcggcggcgat
cacagcctttccatgggcagcgtctccggcatggcgcggtatgccgcgagcaaagaccgc
ccgctcttcgtgctctggcttgatgcccatgccgatttcaactctccggcgacgtcgccc
tccggcaacatccacggcatgccggtcgccttcttctgcggtgaggcggagttcgccgag
atcctgccgaaggaccgtccgttcgtcgatccgaagaatgtcttccaggtcggcatccgt
tcggtcgatgcgcgcgagcgcgaggaaatccacgaacacggcgtcaacgtcttcgatatg
cgcgcgatcgacgagcagggcatcggcgccatcatgcgtgagatcctcgatgtcgtcacc
aaggcgaacggcctgctgcatgtcagcctcgacctcgatttcctcgatcccgagattgcc
cccggcgtcggcacgacggtgcctggcggtgcgactttccgcgaggcgcatctggtgatg
gaaatgctttcggacagcggcctcgtctcgtcactcgatctcgtcgaactcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtggagctgacggcaagcctcttcggc
cgccgcatcttcgatcgtccaacacgcgccgcatag

DBGET integrated database retrieval system