KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0131AHelp
Entry
RL0131A           CDS       T00402                                 

Gene name
recR
Definition
(GenBank) putative recombination protein
  KO
K06187  recombination protein RecR
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rle00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RL0131A (recR)
DNA repair and recombination proteins [BR:rle03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     RL0131A (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RL0131A (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim PHF5
Motif
Other DBs
NCBI-ProteinID: CAK05620
GeneDB: RL0131A
RhizoBase: RL0131A
UniProt: Q1MN32
Position
complement(162809..163414)
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGPLSHAMGEAYDKVKIC
SRCGNVDTVDPCIVCTDVQRDQSVIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLDGV
GPDDLNIRGLIDRVGEGGIRELIIAVNATVEGQTTAHYITDQLQGLDVKITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgagtcaccggccccgaaatcgaaaaactcatccagcttctggcgaaggtg
ccgggcctcgggccgcgttcggcgcgccgggcggcactgcatctgatcaagaagaaggac
cagttgctcggcccgctgtcgcatgcaatgggcgaggcctatgacaaggtgaagatctgc
tcgcgctgcggcaatgtcgatacggtcgatccctgtattgtctgcaccgacgtccaacgc
gatcaatccgtcatcatcgtcgtcgaggacgtatcggatctctgggcgctggagcgggca
ggcgcgatgaacgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggggtc
ggtccagacgatctcaatattcgcggcctgatcgaccgggtcggcgaaggcggcatccgg
gaactgatcatcgcggtcaacgccaccgtcgagggacagacgacggcgcattacatcacc
gaccagctgcaggggctcgacgtgaagatcacgcggctggcgcatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggcacgcttgcggcggcacttcgagcgcggacggtg
atatga

DBGET integrated database retrieval system