KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0560Help
Entry
RL0560            CDS       T00402                                 

Definition
(GenBank) putative epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00520  Amino sugar and nucleotide sugar metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RL0560
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     RL0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind NAD_binding_4 3Beta_HSD Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CAK06053
GeneDB: RL0560
RhizoBase: RL0560
UniProt: Q1MLV0
Position
complement(605557..606603)
Genome map
AA seq 348 aa AA seqDB search
MNYLGRIRAHSVQASARDANCPSGIHRAPKRVLVTGGAGFLGSHLCETLLAAGHQVICLD
NFSTGMRRNIVHLKRVDRFNVVAHDIVHPLDLEVDEIYNLACPASPRHYQADPIHTTKTC
VLGSLNLLELAARTGARILQASTSEVYGDPNVHPQVESYWGNVNSFGPRSCYDEGKRCAE
TLFFDFHNTHGVEIKIIRIFNTYGPRMRPDDGRVVSNFIVQALTGQDITIYGDGSQTRSF
CFVDDLIGGMVRMMASPSSLTGPVNLGNPGEFTIRELAEQVIGLTGSRSQIIHRALPVDD
PRQRRPDISLAMQELDWRPKIDLSSGLRQTIDYFDGLLARPARELEAV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaactatcttggcaggattcgtgcgcactctgtacaagcttcggctcgtgatgcaaat
tgtccatccggaatacatcgcgctcccaagagagttcttgtcaccggcggtgcaggtttc
ctcggatcgcatctgtgcgagacgcttttggccgccggacaccaggtgatctgcctcgac
aacttttccaccggcatgcggcgcaatatcgtccatctgaagcgagtcgatcgcttcaat
gtcgtcgcccacgatatcgtccacccgctcgatctggaagtcgacgagatctataatctc
gcctgcccggcatcgccccggcattatcaggccgatccgatccatacgacaaagacctgc
gtgctgggctccctcaaccttctggagctggccgcgcgcaccggcgcacgtatccttcag
gcatccacatccgaagtctacggcgacccgaacgtccatccgcaggtcgaaagctactgg
ggcaacgtcaattcgttcgggccacgctcctgctatgacgagggcaagcgatgcgccgag
acgctgttcttcgacttccacaacacgcacggcgtcgagatcaagatcatccgcatcttc
aacacctacggcccgcggatgcgtccggacgacggccgcgtcgtctcgaatttcatcgtt
caggctctgacggggcaagacatcacgatatatggcgacggttcccagacccgctcgttc
tgtttcgtcgatgatctcatcggcggcatggtccgcatgatggcctcaccgtcgtcgctg
acggggcccgtcaatctcggcaatccgggcgaattcacgatccgggaattggccgagcag
gtgatcggattgaccggttccaggtcgcaaatcatccatcgcgctctgccggttgacgat
ccccgtcagcgtcgccccgatatttcgctggccatgcaggaactcgactggcggccgaag
atcgacttgtcgagcggcctgcgtcagacgatcgactatttcgatggccttctcgcccgt
ccggcacgcgaactggaggcggtctga

DBGET integrated database retrieval system