KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0648Help
Entry
RL0648            CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RL0648
Enzymes [BR:rle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     RL0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: CAK06142
GeneDB: RL0648
RhizoBase: RL0648
UniProt: Q1MLL1
Position
697931..698602
Genome map
AA seq 223 aa AA seqDB search
MKRSEINAALLRATETLERWHWSLPAWGYWTAADFTSHPEASAYLRAHQLGWDVTDFGSN
RFAECGLVLFCLRNGIVDIRGERTYAEKLLFVGEGQVTPTHRHAAKMEDIINRAGGDLVI
EFAATDADGNVLTEDVTVPVDGLPHRLAAWEPLILQPGQSVTIRTGLYHRFYGRKGGGPV
LVGEVSQVNDDNSDNFFLEPIARFAAIEEDEPPLRPLWNEGVS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctccgagatcaacgccgcgttgctgcgggcaaccgagaccctcgagcgctgg
cactggtccctgccggcatgggggtattggacggcggcggattttacctctcatcccgag
gcatcggcctatttgcgcgcccatcagctgggttgggatgtcaccgatttcggctcgaac
cgcttcgccgaatgcggcctcgtgctgttttgcctgcgcaatggcatcgttgatatcagg
ggtgaacggacctatgccgaaaagctgctcttcgttggcgaagggcaggtcacgccgacg
caccgtcatgcggcgaagatggaagacatcatcaatcgcgccggtggcgatctcgtcatc
gaattcgccgcaaccgatgccgatggcaatgtgctgacggaggatgtgacggtgccggta
gacgggctgccgcaccggctcgctgcatgggagccgctgatcctccagcctggccagagc
gtgacgatccgcaccgggctttatcaccgcttctacggcaggaaaggcggcggacctgtc
cttgtcggcgaggtcagtcaggtcaacgacgacaacagcgacaatttctttctggagccg
atcgcacgctttgccgcgatcgaggaagacgagccgccgctgagacccttgtggaacgaa
ggagtcagctga

DBGET integrated database retrieval system