KEGG   Rhizobium leguminosarum bv. viciae 3841: RL0761Help
Entry
RL0761            CDS       T00402                                 

Gene name
aceA
Definition
(GenBank) putative isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00630  Glyoxylate and dicarboxylate metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01200  Carbon metabolism
Module
rle_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RL0761 (aceA)
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RL0761 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAK06255
GeneDB: RL0761
RhizoBase: RL0761
UniProt: Q1ML98
Position
complement(815983..817272)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNASASRFDGIERPYSAEDVQRLRGSVALSHTLAEMGADRLWRLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLDQARRFAEGVHKV
HPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHGSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttttacaagcttgttccaaatgcatcagccagccgcttcgacggcatcgag
agaccgtactcggccgaagacgtgcagcggctcagaggctcggtggcgctcagccatacg
ctggccgaaatgggggcggaccggttgtggcggcttctgcatcaggaggatttcgtcaat
gcgctcggcgcactttccggcaatcaggccatgcagatggtgcgcgccgggttgaaggcg
atctatctctccggctggcaggtggcggccgacgccaacaccgcatcggcgatgtatccc
gaccagtccctctatccggccaatgccggtccggaacttgccaaacgcatcaatcgcacg
ctgcagcgcgccgatcagatcgagaccgcggaagctcaggggctttccgtcgaaacctgg
ttcgcgccgatcgttgccgatgcggaagcaggcttcggcggaccgctcaacgccttcgaa
atcatgaaggcctatatcgaggcgggtgccgcgggcgttcacttcgaggaccaactcgcc
tcggagaaaaagtgcggtcatctcggcggcaaagtgctgatcccgacggccgcccatatc
cgcaatctcgacgccgcacggcttgccgccgacgtcatgggcgttgcgacgctggtcatc
gctcgcaccgacgcggaagcggcaaagctcttgacgtcagacatcgacgagcgcgaccag
cccttcgtcgactatgatgccgggcgcacggtcgaaggtttctatcaggtgcgaaacggc
atcgagccgtgcatcgcgcgcgccgtcgcctatgcgccgcattgcgatctcatctggtgc
gagacctcgaagccggacctcgatcaggcgcggcgttttgccgaaggcgtgcacaaggtc
catcccggcaagctgctcgcctataattgttcgccttccttcaactggaagaagaacctc
gacgaagcgacgatcgcaaggttccagcgcgaactcggggcgatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgaactggcgcgcggc
taccggcagcggcagatgtcggcctattccgagctgcagcaggcggaattcgccgccgag
gtcaatggctataccgccaccaaacatcagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcttcgaccacggcgatgcacggctcgaccgaa
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system