KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1739Help
Entry
RL1739            CDS       T00402                                 

Gene name
pyrB
Definition
(GenBank) putative aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00240  Pyrimidine metabolism
rle00250  Alanine, aspartate and glutamate metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RL1739 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RL1739 (pyrB)
Enzymes [BR:rle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RL1739 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CAK07234
GeneDB: RL1739
RhizoBase: RL1739
UniProt: Q1MIH6
Position
complement(1828951..1829907)
Genome map
AA seq 318 aa AA seqDB search
MVFFPHRHLIGIKGLTEQDITYLLDKADEAVKISRQREKKTSTLRGLTQINLFFEASTRT
QASFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMRPDVLVIRHSSAGAAALLA
QKVSCSVVNAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
AMGARVRVVAPATLLPAGIAEMGVEVFHSMREGLKDADVVMMLRLQRERMSGAFVPSVRE
YYHFYGLDAETLKAAKDDALVMHPGPMNRGVEIASEVADGPQSVIAEQVEMGVAVRMAVM
ETLLVSQNQGPRSDGMMA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtctttttcccccaccgccacctcatcggcatcaagggcctcaccgagcaggatatc
acctatcttctcgacaaggcggacgaggccgtcaagatcagccgccagagagagaagaaa
acgtcgacgctgcgcgggctgacgcagatcaacctcttcttcgaggcatcgacccgcacg
caggcctccttcgagcttgccggcaagcggctcggcgccgacgtcatgaacatgtcggtc
ggcaattcctctgtgaagaaaggcgaaacgctgatcgacacggcgatgacgctgaatgcg
atgcgccctgatgtgctggtgatccgccattcgagcgcgggagcggccgcccttctcgcc
cagaaggtctcctgttcggtcgtcaatgccggcgacgggcagcatgaacatccgacccag
gcgctgctcgacgcgctgacgatccgccgcgccaaggggaagctgtcgcgcatcatcgtg
gcgatctgcggcgacgtgctgcattcgcgggtggcgcgctccaatattctgctgctcaat
gccatgggcgcccgcgtccgtgtcgttgcgcccgcgaccctcctgccggccggcatcgcc
gagatgggcgtcgaggtcttccattcgatgcgggaagggctgaaggacgccgacgtggtg
atgatgctgcggctgcagcgcgagcgcatgtccggcgccttcgtgccttcggtgcgcgaa
tactatcacttctacgggctcgacgccgaaacgctgaaagcggcgaaggacgacgcgctg
gtcatgcatcccggcccgatgaatcgcggcgtcgagatcgcttcggaagtggcggacgga
ccgcagagcgtcatcgccgaacaggtggaaatgggggtcgcggtgcgcatggccgtcatg
gagacgctgctcgtctcgcagaaccagggtccccgaagcgatggaatgatggcatga

DBGET integrated database retrieval system