KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1891
Entry
RL1891            CDS       T00402                                 

Definition
(GenBank) putative transmembrane protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB
Motif
Pfam: ICMT PEMT ERG4_ERG24 ABC_membrane
Other DBs
NCBI-ProteinID: CAK07385
GeneDB: RL1891
RhizoBase: RL1891
UniProt: Q1MI25
Position
1986230..1986907
AA seq 225 aa
MSDTPAYGLWSLVIINSVVFIVFAASFTRLETKRDWRSLGAFSAFVVALFTEMYGFPLTI
YLLSGWLGRQFRGVDFWSHDAGHLLEMMFGWRVNPHFGLFHLASSVLIMAGFWLLALSWH
VLYAAQQNHRLATTGPYARVRHPQYDAFVVIMIGFLLQWPTLVTLAMFPVLVWVYVHLAK
REEEASRAEFGAAWDAYARAVPRFLPRFGRGTDAAGSHRGGAVHD
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtctgacactcccgcctatggactctggagcctcgtgatcatcaactccgtggtgttc
atcgtcttcgccgcgagcttcacccggctcgagaccaagcgcgactggcgatcgctcggc
gctttctccgccttcgtcgtggcgctcttcacggagatgtacggcttcccgctgaccatc
tatctgctgtccggctggcttggccgacagtttcgaggcgtcgacttctggtcccacgac
gccggccacctgctggaaatgatgttcggctggcgtgtcaacccgcatttcgggctgttt
cacctcgcaagcagcgtcctgatcatggccggcttctggttgctcgccttgagctggcat
gtgctctacgccgcccagcagaaccatcgcctggcgaccaccgggccatacgcgcgggtc
cggcacccgcaatacgacgccttcgtcgtcatcatgatcggattcctgctacagtggccg
accctggtgacgctagccatgttcccggtgcttgtctgggtttacgtgcaccttgcgaag
cgggaggaggaggcttcgcgggccgagttcggagctgcatgggacgcctatgcccgagcg
gttccccggttcctcccgaggttcggccgcggaacggatgccgctggaagccatcgcgga
ggagctgtccatgactga

DBGET integrated database retrieval system