KEGG   Rhizobium leguminosarum bv. viciae 3841: RL2377Help
Entry
RL2377            CDS       T00402                                 

Definition
(GenBank) putative solute-binding component of ABC transporter
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RL2377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    RL2377
Enzymes [BR:rle01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     RL2377
Transporters [BR:rle02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    RL2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 AAA_30 RsgA_GTPase AAA_16 AAA_22 AAA_27 Zeta_toxin MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CAK07867
GeneDB: RL2377
RhizoBase: RL2377
UniProt: Q1MGQ2
Position
2499122..2500645
Genome map
AA seq 507 aa AA seqDB search
MIHDFENVLAASGISKFFPGAVALDKVDFTLRRGEVHALLGENGAGKSTLIKCITGAYHR
DEGSLTLDGQEINPANTLAAQKLGIGTVYQEVNLLANLSIAENLFLGRQPRRFGMTDVRA
MNRKARDLLSGYGVDIDVTAELGRFSVAVQQVVAIARAVDLSGKVLILDEPTASLDNQEV
ALLFRIIDDLKKRGLGIVFITHFLEQVYAISDRITVLRNGKLVGTRDAADLPRQGLIAMM
LGRELAHVEETVRERSLAAGDVRYRFAGYGKRGKVKPFDLEVRAGEVVGVAGLLGSGRTE
TAELLFGIEHADSGSATIDGQPATISSPRAAIAKGFGFCPEDRKTDGIIGDLSIRENIAL
ALQARRGWTRPLSRAEQNTLADRYIKALDIRTTDREKPIRLLSGGNQQKAILARWLATNP
KFLILDEPTRGIDVGAHAEIIRLIEELCAGGMSLIVISSELEELVAYSSRVIVLRDRQHI
AELTGERITAAGIVEAIAAAEHKMEDA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatttcgagaacgttctcgcggcttccggaatatcgaaattctttcccggc
gcagtggcgctggacaaggtcgatttcacgctccgcagaggcgaggtgcatgcgttgctg
ggcgaaaacggcgccggcaagtcgacgctgatcaagtgcatcaccggcgcctatcatcgt
gacgagggcagcctgacgctggacggccaggaaatcaatccggccaatacgctcgccgcc
cagaagctcggcatcggcacggtctaccaggaggtcaacctgctggccaatctgagcatt
gccgaaaatctctttctcggccgccagccgaggcgcttcggcatgaccgacgtgcgtgcg
atgaaccgcaaggcacgcgacctgctctccggctacggcgtcgatatcgacgtcaccgcc
gaactcggccgtttctccgtcgccgtccagcaggtggttgccatcgcccgtgccgtcgat
ctctccggcaaggtgctgatcctcgacgagcccaccgcaagtctcgacaatcaggaagtg
gcgctgctcttccgcatcatcgacgacctcaagaagcgcggcctgggcatcgtcttcatc
acccattttctcgagcaggtctatgcgatcagcgaccgtatcaccgtgctgcgcaacggc
aagctggtcggcacccgcgacgccgccgatctgccgcgccagggcttgatcgccatgatg
ctcggccgcgaactggcgcatgtcgaagagaccgtcagggaacgcagccttgcggccgga
gacgtccgataccgttttgcaggctacggcaaacgcggcaaggtcaaaccattcgacctt
gaggtgcgcgccggagaggttgtcggcgtcgccgggttgctcggttccgggcgcaccgaa
accgccgaactgctcttcggcatcgagcatgccgacagcggcagcgccacgatcgacggc
cagcccgcgacgatttctagcccgcgcgcggcgatcgcaaaaggcttcggcttttgcccc
gaggaccgcaagaccgatggcatcatcggcgacctgtcgatcagggagaacatcgcactg
gcgctgcaggcccgccgcggctggacgcggccgctgtcgcgcgccgagcagaatacgctt
gccgaccgctacatcaaggcgctcgatatccgcaccaccgatcgcgagaagccgatccgg
ctactgtcaggcggcaatcagcaaaaggcgatcctcgcccgctggctggcaaccaatccg
aagttcctgatcctcgacgagccgacccgcggcatcgatgtcggcgcccatgccgagatc
atccggctcatcgaagaactctgcgccggcggcatgtcgctgatcgtgatttcctcggaa
cttgaagagcttgtcgcctatagttcacgtgtcatcgtattgcgcgacaggcagcatatc
gccgaactgacaggcgagcgtatcaccgctgccggcatcgtcgaagccattgccgccgcc
gaacacaagatggaggatgcatga

DBGET integrated database retrieval system