KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3344Help
Entry
RL3344            CDS       T00402                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00071  Fatty acid degradation
rle00350  Tyrosine metabolism
rle00625  Chloroalkane and chloroalkene degradation
rle00626  Naphthalene degradation
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL3344
  Lipid metabolism
   00071 Fatty acid degradation
    RL3344
  Amino acid metabolism
   00350 Tyrosine metabolism
    RL3344
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RL3344
   00626 Naphthalene degradation
    RL3344
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RL3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAK08831
GeneDB: RL3344
RhizoBase: RL3344
UniProt: Q1MDZ6
Position
complement(3509650..3510801)
Genome map
AA seq 383 aa AA seqDB search
MSSNITANWSYPTSVKLGRGRIAELADACKSLGIKKPLLVTDRGLASMAITKTALDILED
AGLGRAIFADVDPNPNEKNLEAGVRAFKDGGHDGVVAFGGGSGLDLGKCVAFMAGQTRPV
WDFEDIGDWWTRASLEGIAPIVAVPTTAGTGSEVGRASVITNSETHVKKIIFHPKFLPGV
VISDPELTVGMPKIITAGTGMDAFAHCLEAYSSPFYHPMSAGIALEGMRLVKEFLPRAYR
EGTDLEARANMMAAAAMGAVAFQKGLGAIHALSHPIGAVYNTHHGMTNAVVMPAVLRFNR
KAIEEKIGRAAAYLGISGGFDGFYDYVLKLRSELGVPETLSAMGIAADRIDELSAMAIED
PSAGGNPIAMTLENTKALFRDCF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacatcaccgcaaactggagctatccgacatcggtcaagctcggccggggc
cgcatcgcggaactggccgacgcctgtaaaagcctcggcatcaagaagccgctgctcgtc
accgaccgtggccttgcctcgatggcaatcaccaagactgcgctcgatatcctcgaagat
gccggtctcggccgggcgatctttgccgatgtcgatccaaacccgaacgagaagaacctc
gaagccggcgtcagggccttcaaggacggcggccatgacggcgtcgttgctttcggtggc
ggctccggcctcgatctcggcaagtgcgtcgctttcatggccggccagacgcggccggtt
tgggacttcgaagatatcggcgactggtggacgcgtgcgagcctcgagggcatcgccccg
atcgtcgcggtgccgacaacggcaggcaccggttcggaagtcgggcgcgccagcgtcatc
accaattccgaaactcatgtgaagaagatcatcttccatccgaagttcctgcctggcgtc
gtcatttccgatccggaactgacggttggcatgccgaagatcatcacggccggcaccggc
atggatgctttcgcccattgcctggaggcctattcctcgccgttctatcacccgatgtca
gccggcatcgcgctcgaaggcatgcggctcgtcaaggaattcctgccgcgcgcctatcgg
gaaggcacggatctggaggctcgcgccaacatgatggccgccgccgccatgggcgcggtc
gccttccagaaggggctcggcgccattcacgcgctgtcgcacccgatcggcgccgtctac
aacacccatcacggcatgaccaacgcggtggtgatgccggcggtgctgcgctttaaccgc
aaggcgatcgaggagaagatcggccgtgcggcggcctatctcggcatttcgggcggtttc
gacgggttctacgattatgtgctgaagctccgctccgaactcggcgtgccggagacgctg
tcggcaatgggaatcgctgccgaccgcatcgacgaattgtcggccatggcgatcgaagat
ccgagtgctggcggcaacccgattgcaatgacgctcgaaaataccaaggcccttttcagg
gattgcttctga

DBGET integrated database retrieval system