KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3454Help
Entry
RL3454            CDS       T00402                                 

Definition
(GenBank) putative two-component response regulator transcriptional regulatory protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RL3454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rle02022]
    RL3454
Two-component system [BR:rle02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   RL3454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE
Motif
Other DBs
NCBI-ProteinID: CAK08942
GeneDB: RL3454
RhizoBase: RL3454
UniProt: Q1MDN5
Position
complement(3627999..3628700)
Genome map
AA seq 233 aa AA seqDB search
MAVKTDISDDAAHLLVVDDDSRIRALLNRYLAENGFRVTVAADGAEAQRKLAGLDFDLII
MDVMMPGESGIEVTRGLRAIKNVPIIMLTALAESGNRIEGLEAGADDYLSKPFDPRELVL
RINNILRRNAGGEGPKIEQVMFGPYTFSLTRKELKKASEVIRLTDREQEIMLLFARRAGD
TIPRHELIGNDTEVGERTIDVQINRLRRKIEDDPANPVWLQTVRGIGYRLSID
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaagacagatatttccgacgatgcggcgcacttgctggtggtcgatgacgac
tcccgcatccgtgcgctgctcaatcgctatctcgccgaaaacggcttccgcgtcaccgtc
gccgccgacggcgccgaggcgcagcgcaagcttgcgggtctcgacttcgacctgatcatc
atggatgtgatgatgcccggtgaatccggcatcgaggttacccgcgggcttcgcgccatc
aagaacgtcccgatcatcatgctgacggcgctggcagaatcgggcaaccgcatcgaaggc
ctcgaggcgggcgccgacgactatctttccaagcccttcgacccgcgcgaactggtgctg
cgcatcaacaacatcctgcgccgcaacgccggcggcgagggaccgaagatcgaacaagtg
atgttcggcccctacaccttctcgctgacccgcaaggagctgaagaaagccagcgaggtg
atccggctcaccgaccgcgagcaggagatcatgctgctctttgcgcggcgcgccggcgat
acgatcccccgccatgaactgatcggcaacgataccgaagtcggcgagcggacgatcgac
gtgcagatcaaccggctgaggcgtaagatcgaggacgatcccgccaatcccgtctggctg
cagaccgtgcgcggcatcggatacaggctgagcatcgactaa

DBGET integrated database retrieval system