KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4433Help
Entry
RL4433            CDS       T00402                                 

Gene name
citM
Definition
(GenBank) putative dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00020  Citrate cycle (TCA cycle)
rle00310  Lysine degradation
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
Module
rle_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RL4433 (citM)
  Amino acid metabolism
   00310 Lysine degradation
    RL4433 (citM)
Enzymes [BR:rle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RL4433 (citM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CAK09919
GeneDB: RL4433
RhizoBase: RL4433
UniProt: Q1MAW6
Position
complement(4713719..4714996)
Genome map
AA seq 425 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV
VAAGETVGLGALLGQIAEGAAAAAAPAAAAPTAAPAAPAPAQPAAAAPAQPAVAAAAASS
SSASVSTMPPAPAASKMLAENNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAVPAAT
PAAARGPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKY
KDIFEKKHGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLV
VPVIRDADQMSIAEIEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNA
PQSGILGMHKIQERPVAIGGQVVIRPMMYLALSYDHRMVDGKEAVTFLVRVKESLEDPER
LVLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccgattctcgagcttgaa
accgacaaggtgaccatcgaagttccagcacccgcctccggcacgctttcggaaatcgtt
gtcgccgccggcgagacagtcggcctcggcgcattgctcggccagatcgccgaaggtgcc
gccgctgccgccgcgccggctgccgctgcaccgaccgccgctcctgctgctccggctccc
gcccaaccggccgctgctgctccggcccagccggcggttgccgccgctgctgcgtcgtcc
tcgagcgcctccgtctccaccatgccgccggcgcctgcggcttcgaagatgcttgccgaa
aacaacctttccgccgatcaggtcgacggtagcggcaagcgcggccaggtgctgaagggc
gacgtcatcgccgccgtcgccaagggcatttccgctccggcggccgtacccgcggcgacg
cctgccgccgcgcgcggcccgtcgacggtcgaggatgcctcgcgcgaagagcgcgtgaag
atgacgcgcctgcgccagacgatcgccaagcgcctcaaggatgcgcagaacaccgccgcc
atgctgaccacctacaatgaggtggacatgaaggcggtcatggacctgcgcaacaagtac
aaggacattttcgagaagaagcacggcgtcaagctcggcttcatgggcttcttcaccaag
gcggtgacgcatgcgctgaaggaactgccggccgtcaacgccgaaatcgacggcaccgac
gtcatctacaagaactactgccatgtcggcatggccgtcggcacggacaaaggtctcgtc
gttcccgtcatccgcgacgccgaccagatgtcgatcgccgaaatcgagaaggagctcggc
cgtcttgccaaggcagctcgtgatggctcgctctccatggccgacatgcagggcggcacc
ttcaccatcaccaatggcggcgtttacggttcgctgatgtcttcgccgatcctcaacgcg
ccgcagtccggcattctcggcatgcacaaaatccaggagcggccggtcgcgatcggcggt
caggtggtcattcgcccgatgatgtatctggcgctgtcctacgatcaccgcatggtcgac
ggcaaggaagcggtcaccttcctcgtgcgcgtgaaggaaagcctggaagatccggaacgt
ctggttctcgatctttaa

DBGET integrated database retrieval system