KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4438Help
Entry
RL4438            CDS       T00402                                 

Gene name
sucC
Definition
(GenBank) putative succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00020  Citrate cycle (TCA cycle)
rle00640  Propanoate metabolism
rle00660  C5-Branched dibasic acid metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
Module
rle_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RL4438 (sucC)
   00640 Propanoate metabolism
    RL4438 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RL4438 (sucC)
Enzymes [BR:rle01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RL4438 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A FimP
Motif
Other DBs
NCBI-ProteinID: CAK09924
GeneDB: RL4438
RhizoBase: RL4438
UniProt: Q1MAW1
Position
complement(4719933..4721126)
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLKGYGAPVAEGVAILKVEEAEAAAKSLPGPLYVVKSQIHAGGRGKGKFK
ELSPEAKGGVRLAKSIDEVVAHAKEMLGNTLVTAQTGEAGKQVNRLYIEDGADIARELYC
SLLVDRSVGRVAFVVSTEGGMDIEAVAHDTPEKIQTIAIDPEAGVTAADVAAISKAFELE
GAAAEDAKTLFPMLYKAFGEKDMALLEINPLIVMKDGHLRVLDAKMSFDGNALFRHDDVK
VLRDETEEDAKEIEASKWDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGKEPANFCDVG
GGAGKEKVAAAFKIITADPKVEGILVNIFGGIMKCDVIAEGVIAAVKEVGLKVPLVVRLE
GTNVELGKKILNESGLAITAADDLDDAAKKIVAAING
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaggccaaggctctgctgaagggctatggcgcgccggttgcc
gaaggtgtggctattctcaaggttgaagaagccgaggctgccgccaagtcgcttcccggc
ccgctttacgtggtcaagagccagatccatgccggcggccgcggcaagggcaagttcaag
gaactgtcgccggaagccaagggcggcgtgcgtctcgccaagtcgatcgacgaagtcgtc
gcccatgccaaggaaatgctgggcaacacgctggtgacggcgcagaccggcgaagccggc
aagcaggtcaaccgcctgtacatcgaagacggcgccgacatcgctcgcgagctctattgc
tcgctgctggtcgaccgctcggtcggtcgcgtggctttcgtggtctccaccgaaggcggc
atggacatcgaagctgtcgcccacgacacgcctgagaagatccagacgatcgccatcgat
ccggaagccggcgtgacggctgccgacgttgctgcgatctccaaggcttttgagctcgag
ggtgctgccgccgaagacgccaagacgcttttcccgatgctctacaaggccttcggcgag
aaggacatggctctgcttgagatcaatccgctgatcgtcatgaaggacggccacctgcgc
gtcctcgatgccaagatgtctttcgatggcaatgcgctcttccgtcacgacgacgtcaag
gtgctgcgcgacgagaccgaagaagacgccaaggaaatcgaggcctcgaagtgggacctc
gcctatgtcgcgctcgacggcaatatcggctgcatggtcaatggtgcgggccttgccatg
gcgacgatggacatcatcaagctctacggcaaggagccggctaacttctgcgacgtcggc
ggtggcgccggcaaggagaaggttgctgcggctttcaagatcatcaccgcagaccccaag
gtcgaaggcattctcgtcaacatcttcggcggcatcatgaagtgcgatgtcattgccgag
ggcgtcattgctgcggtcaaggaagtcggtctcaaggttccgctcgtcgtgcgccttgaa
ggcaccaatgtcgagctcggcaagaagatcctgaacgagtcgggtctggcgatcacggcg
gctgacgacttggacgatgcggccaagaagatcgtcgcggcgatcaacggctga

DBGET integrated database retrieval system