KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4621Help
Entry
RL4621            CDS       T00402                                 

Gene name
phaA
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00071  Fatty acid degradation
rle00072  Synthesis and degradation of ketone bodies
rle00280  Valine, leucine and isoleucine degradation
rle00310  Lysine degradation
rle00362  Benzoate degradation
rle00380  Tryptophan metabolism
rle00620  Pyruvate metabolism
rle00630  Glyoxylate and dicarboxylate metabolism
rle00640  Propanoate metabolism
rle00650  Butanoate metabolism
rle00900  Terpenoid backbone biosynthesis
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
rle01212  Fatty acid metabolism
rle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RL4621 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    RL4621 (phaA)
   00640 Propanoate metabolism
    RL4621 (phaA)
   00650 Butanoate metabolism
    RL4621 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RL4621 (phaA)
   00072 Synthesis and degradation of ketone bodies
    RL4621 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RL4621 (phaA)
   00310 Lysine degradation
    RL4621 (phaA)
   00380 Tryptophan metabolism
    RL4621 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RL4621 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RL4621 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RL4621 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rle04147]
    RL4621 (phaA)
Enzymes [BR:rle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RL4621 (phaA)
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RL4621 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAK10104
GeneDB: RL4621
RhizoBase: RL4621
UniProt: Q1MAD4
Position
complement(4914085..4915266)
Genome map
AA seq 393 aa AA seqDB search
MSNPSIVIASAGRTAVGAFNGAFATVLAHELGAAVIKGALERAGVDAGEVDEVILGQVLA
AGEGQNPARQAAMKAGIPQEATAWGVNQLCGSGLRAVALGMQQIATGDAKIIVAGGQESM
SMAPHAAHLRGGVKMGDMKMIDTMIKDGLTDAFHGYHMGITAENVARQWQLSRDDQDQFA
VSSQNKAEAAQKAGRFTDEIIPYVIKTRKGDVTVDADEYIRHGATIEAMGKLRPAFDKDG
TVTAANASGLNDGAAVAVLMSEAEAVRRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LEKAGWSVNDLDLVEANEAFAAQACAVTKDLGWDPSIVNVNGGAIAIGHPIGASGARVLN
TLLFELKRRGAKKGLATLCIGGGMGVAMCFEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccatccatcgtcatcgccagtgcagggcgaacagcagtcggcgccttcaac
ggtgctttcgcgacggtcctcgcgcatgagctcggggcggctgtcatcaagggcgcgctc
gagcgcgccggcgtcgatgccggcgaggtggatgaggtgatcctcggccaggtgcttgcc
gccggcgagggtcagaacccggcccgccaggcggcgatgaaggccggcattccgcaggaa
gcaacggcctggggcgttaaccagctttgcggctcgggcttgcgcgccgtcgcgctcggc
atgcagcagatcgccacaggcgatgccaagatcatcgttgccggcggccaggaatccatg
tcgatggccccgcatgccgcgcatctgcgcggcggcgtcaagatgggcgacatgaagatg
atcgacacgatgatcaaggacggcttgaccgacgccttccacggctaccacatgggcatc
accgccgagaatgtcgcgcgccagtggcagctttcgcgcgacgaccaggatcagttcgcg
gtcagctcgcagaacaaggccgaggcggcccagaaggccggccgctttaccgacgagatc
atcccttatgtcatcaagacacgtaagggcgacgttacggtcgacgccgacgaatatatc
cgtcacggcgcgacgatagaggcgatggggaagctgcgcccggccttcgacaaggacggc
acggtcacggccgcgaacgcttccggcctcaacgacggtgccgctgtggcggtgctgatg
agcgaagctgaggcagtccggcgcggcatccagccgctcgcccgcatcgtttcctgggca
acggcgggtgtcgatccgcagatcatgggcaccggaccgatcccggcttcgcgcaaggcg
ctcgagaaggccggctggtcggtcaacgatctcgatcttgtcgaagccaacgaggctttc
gcggcgcaagcctgcgccgtcaccaaggatctcggatgggatccgtcgatcgtcaacgtc
aacggcggggcgatcgcgatcggccatccgatcggcgcctccggcgcgcgcgttctcaac
acgctgctgttcgaattgaagcgccgcggcgcgaagaagggtcttgccacgctttgcatc
ggcggtggcatgggtgtggccatgtgctttgaagcgctttaa

DBGET integrated database retrieval system