KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4628Help
Entry
RL4628            CDS       T00402                                 

Gene name
ispA
Definition
(GenBank) putative geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00900  Terpenoid backbone biosynthesis
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RL4628 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rle01006]
    RL4628 (ispA)
Enzymes [BR:rle01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     RL4628 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     RL4628 (ispA)
Prenyltransferases [BR:rle01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   RL4628 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: CAK10111
GeneDB: RL4628
RhizoBase: RL4628
UniProt: Q1MAC7
Position
4919380..4920294
Genome map
AA seq 304 aa AA seqDB search
MDANRDTFETRLKNNARDIEALLDALLSPSAFSDEIARPETLRDAMHYAVLNGGKRLRPF
LVVESAALLGGDAEAALRVGAALECVHCYSLVHDDLPAMDDDDLRRGKPTVHIKFDEATA
ILAGDSLLTYAFDIIAAPETTLADTSKASLVLALARAAGLGGMAGGQALDLAAEKQAPDE
AGIIRLQAMKTGALIRFACEAGAVISGSLAEDRRRLRAFGEKIGLAFQLADDILDLTSDA
ATMGKATGKDAARGKGTLVALRGMEWAETQLREHVRDAEALLAPYGARASILIAAAHFIA
DRKS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaaccgggatactttcgagacaaggctgaagaacaacgcccgcgacatcgag
gcgctgctcgacgcattgctttcaccgagtgccttttccgatgaaatcgccaggcccgag
acgctgcgcgatgccatgcattatgccgtgttgaacggcggcaagcggctgcgcccgttt
ctggtcgtcgaaagtgccgcccttctcggcggcgacgccgaggcggcacttcgcgtcggc
gccgcactcgaatgcgtccactgctactccctcgtgcatgacgacctgccggccatggac
gatgacgacctgcgccgcggcaaaccgacagtacacatcaagttcgacgaagcgacggcg
atcctcgccggcgacagcctgctgacctatgccttcgacatcatcgccgcgccggaaacg
acccttgccgatacgagcaaggcatcgctggtgctggcccttgcccgcgcagccggtctc
ggcggcatggccggcggccaggcgcttgatctcgcggcggaaaagcaggcgcccgacgag
gccggcatcatccgcctgcaggcgatgaaaacgggcgcgctgatccgcttcgcctgcgaa
gccggcgccgtcatctcgggaagcttggccgaagatcgccgccgcctgcgcgccttcggc
gaaaagatcggtcttgctttccagcttgccgacgacattctcgacctgacttcggatgca
gcgaccatgggcaaggcgaccggcaaggatgcggcccgcggcaagggaacactcgtcgcc
ctgcgcggcatggaatgggccgagacccagctccgtgagcacgtccgcgatgccgaagcg
ctgcttgccccttacggcgcccgcgcctcgatcctcattgctgcagcgcatttcatcgcc
gaccggaagagctga

DBGET integrated database retrieval system