KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100301Help
Entry
pRL100301         CDS       T00402                                 

Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00071  Fatty acid degradation
rle00072  Synthesis and degradation of ketone bodies
rle00280  Valine, leucine and isoleucine degradation
rle00310  Lysine degradation
rle00362  Benzoate degradation
rle00380  Tryptophan metabolism
rle00620  Pyruvate metabolism
rle00630  Glyoxylate and dicarboxylate metabolism
rle00640  Propanoate metabolism
rle00650  Butanoate metabolism
rle00900  Terpenoid backbone biosynthesis
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
rle01212  Fatty acid metabolism
rle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    pRL100301
   00630 Glyoxylate and dicarboxylate metabolism
    pRL100301
   00640 Propanoate metabolism
    pRL100301
   00650 Butanoate metabolism
    pRL100301
  Lipid metabolism
   00071 Fatty acid degradation
    pRL100301
   00072 Synthesis and degradation of ketone bodies
    pRL100301
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    pRL100301
   00310 Lysine degradation
    pRL100301
   00380 Tryptophan metabolism
    pRL100301
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    pRL100301
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    pRL100301
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    pRL100301
Enzymes [BR:rle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     pRL100301
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   pRL100301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAK10526
GeneDB: pRL100301
RhizoBase: pRL100301
UniProt: Q1M7K3
Position
pRL10:313741..314928
Genome map
AA seq 395 aa AA seqDB search
MTLQDPIVIVGAARTPIGSFQGELKEATAPELGATAIRAALQRSGVEAATIEEVVFGCVL
PAGQGQAPARQAAIHAGLPFATAASTVNKMCGSGMKAVMMAHDLIAAGSASVAVAGGMES
MTNAPYLLDKARGGYRLGHGRVVDHMFLDGLEDAYDKGRLMGSFAEDCAEAYQFTREAQD
SYAIASLARAQKAIAEGCFDSEIAAVTVKSSKVEQVASRDEQPGKAKLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRRSEAEHRGLKPLATILGHATHSQAPNLFATAPIGALQ
KLSDRTGLPLSEVDLFEINEAFAVVAMAAMRDLNLPHEKVNVHGGACALGHPIGASGARI
LVTLLAALERYDLKRGMAALCIGGGEATAVAIERQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcaggatcccatcgtcatcgtcggtgcggcgcgcaccccaattggcagcttt
cagggagagctgaaggaggcgacagcgccggaactcggagcaacggcgatccgcgcggcg
ctgcagcggagcggcgtcgaggctgcgacgatcgaggaggtcgtcttcggctgtgtactg
ccggcagggcaggggcaagcgccggcgcgccaggcggcgatccatgccggtctgcctttc
gcgaccgcggccagcaccgtcaacaagatgtgcggctcgggcatgaaggcggtcatgatg
gcgcatgacctgatcgccgccggcagcgcctcggtggcggtcgcgggcggcatggaaagc
atgaccaatgcgccctatctccttgacaaggcccgtggcggctacaggctcggccatggg
cgtgtcgtggatcacatgttcctcgacgggctggaggatgcttatgacaaggggcgcttg
atgggcagcttcgcggaggattgcgccgaggcctatcagttcacgcgcgaggcgcaggat
agctacgccatcgcctcgctggcgcgggcgcagaaggcgattgccgaaggctgtttcgac
agtgagatcgcggcggtcacggtgaaatcgagcaaagtcgagcaggtggcgagccgcgac
gaacagcccggaaaagcgaagctggataagatcccgacgctgaagcccgccttccgcgag
ggcggcacggtgaccgccgccaattccagctcgatttccgatggcgcggcagcgctggtg
ctgatgcgccgctccgaggcggagcatcgcggcctcaagccgcttgcgactatcctcggc
catgccacgcattcacaggcgcccaatcttttcgccacggcgccgatcggcgcgctgcag
aaactgtccgatcgcaccggcctgccgctgtcggaggtcgatctgttcgaaatcaacgag
gctttcgccgtcgttgccatggcggcgatgcgcgatctcaacctgccgcatgaaaaagtg
aatgtgcatggcggcgcctgcgcgctcggccatccgatcggcgcctcgggggcccgcatc
ctggtgacgctgcttgccgcactggagcgatacgatctgaagcgcggtatggccgcgctc
tgcatcggtggcggcgaggcgacggctgtcgccatcgagcggcaatag

DBGET integrated database retrieval system