KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100343Help
Entry
pRL100343         CDS       T00402                                 

Gene name
pit2
Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
KEGG Orthology (KO) [BR:rle00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    pRL100343 (pit2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAK10569
GeneDB: pRL100343
RhizoBase: pRL100343
UniProt: Q1M7G3
Position
pRL10:353205..354209
Genome map
AA seq 334 aa AA seqDB search
MDASLALPLLVGLVVIALFFDFLNGLHDAANSIATIVSTRVLRPQYAVAWAAFFNFIAFL
FFGLHVAETLGTGIIDPAIVSPQVIFAALMGAIIWNIITWIFGIPSSSSHALVGGLVGAG
LAKVGFSSIVWNGLLKTVGAIFVSPAIGFLLALVLVLAVSWLFVRQTPFAVDRTFRVMQF
VSASLYSLGHGGNDAQKTMGIIAVLLFSQGYLGPTFYVPFWVVISCQSAMALGTLFGGWR
IVHTMGSKITRLNPMQGFCAETGGALTLFGATWLGIPVSTTHTITGAIVGVGAARRVSAV
RWGLAGNIVIAWIVTMPAAAAISAAFYGLVSLLQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcctccctcgctctgccgctgctggtcggcctggtcgttatcgccctgttcttc
gactttctcaatggtctgcatgacgcggccaattcgatcgccacgatcgtctcgacccgc
gtcctgcggccacaatatgcggtcgcctgggcggcgttcttcaatttcatcgcattcctg
ttcttcggcctgcatgtcgccgaaacactggggaccggcatcatcgatcctgcgatcgtt
tcgccacaagtgatcttcgcagcactcatgggcgcgatcatctggaatatcatcacctgg
attttcgggattccgtcgagctcgtcgcatgcgcttgtcggtgggctggtgggggcgggt
ctcgcaaaggtgggcttcagctcgatcgtctggaacggccttctaaaaaccgtcggtgct
attttcgtatcgccagccatcggctttctacttgccctggtgctcgtgctggccgtctcc
tggctattcgtccggcaaacaccatttgcggtggatcgcacatttcgcgtcatgcagttc
gtgtccgcttcgctctattcgcttggccatggcgggaacgatgcgcagaagacgatgggc
atcatcgcggtgctcttgttcagccagggatatctcggcccgacattctacgtgcctttc
tgggtggtcatttcctgccagtcggcaatggctctcggtacgctctttggcggatggcgg
atcgttcataccatggggtcgaagatcacccggctcaaccccatgcaaggtttctgcgca
gagaccggcggagcgttgacactcttcggagcgacgtggctcggtattcccgtttcgacg
acgcataccatcaccggagcaatcgttggagtgggtgcggctcgtcgtgtctcagccgtg
cgctggggattggcgggcaacatcgtgatagcctggatcgtcacgatgccggcggctgca
gcaatatccgcggcgttctacggcctcgtatctttgctgcaatga

DBGET integrated database retrieval system