KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100377Help
Entry
pRL100377         CDS       T00402                                 

Definition
(GenBank) putative acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00620  Pyruvate metabolism
rle00640  Propanoate metabolism
rle00680  Methane metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL100377
   00620 Pyruvate metabolism
    pRL100377
   00640 Propanoate metabolism
    pRL100377
  Energy metabolism
   00680 Methane metabolism
    pRL100377
Enzymes [BR:rle01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     pRL100377
Lipid biosynthesis proteins [BR:rle01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   pRL100377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding CPSase_L_D2 ATP-grasp_2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAK10603
GeneDB: pRL100377
RhizoBase: pRL100377
UniProt: Q1M7C9
Position
pRL10:389101..391155
Genome map
AA seq 684 aa AA seqDB search
MTPRPLDRLLRPQTIAVFGGREARRVIEQCDRMGFAGEIWPVHPKLDEVLGRPCYRSVSD
LPSAPDAAFVGVNRMLTVEIVRSLSEAGAGGAVCYASGFSEATGELGDGAELQQALLQAA
GDMPILGPNCYGLINGLDGALLWPDQHGMQRIERGVAILTQSSNIAINLTMQTRGVPIAY
VVTAGNQAQTSLADVACALIDDPRVTAVGLHVEGFGDLSALERLATMARRSRKPVVVLKV
GRSEQAKRAAVSHTASLAGSDAVADAVLARLGLGRVQTLPALLETLKLLHVAGPLASHSI
SSMSCSGGEASLMADAAVGRNVEFAALQPQQLPRLRRVLGEMVTLSNPLDYHTFVWGDLA
RQIEAFSAMFEGGYALNLVVLDFPRGDRCDASEWAMTADAVMTAAAATGALAGLLATLPE
NMPEPIADRLMANGIVAFCGIDETIVAAEVAAGIGRAWDRPAPLPLLDVSPMDGEIETLT
EADAKAELAAFGLPIPRGLLASSPGQAAEQAERLGFPVVLKALGIAHKTEAGAVALNLED
IKAVSNAAAAMPPNAGYLVEKMIDPPVAELIVGAIRDPVFGLSLTLGAGGIFVELLEDSI
ILPLPATKTDIRAAISRLKLAKLIGGYRGRPKGDLEAAVGVVSATADYVVKNAACLEELD
INPLMVLPEGRGVAVVDALIRRRR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctcgcccgctcgaccgcctgctcagaccgcaaacgatcgccgtcttcggcggc
cgtgaggcgcgcagggtgatcgagcaatgcgaccgcatgggttttgccggtgagatctgg
cctgttcatccgaagctcgacgaggtgctggggcggccctgttatcgctccgtatccgac
ctgccttcggctccggacgccgccttcgtcggcgtcaataggatgctgaccgtcgagatc
gtccgtagcctttctgaggccggtgccggcggtgcagtttgttatgcatcgggtttcagc
gaggcgacgggtgaactcggcgacggtgccgaactgcagcaggcccttttgcaggcggcc
ggcgacatgccgatcctcgggccgaattgctacggactgatcaacggtctcgacggtgcg
ctgctgtggcccgatcagcatggcatgcagcgtatcgaacgtggcgtcgcgatcctcaca
caatcctccaatatcgccatcaacctgaccatgcagacccgcggcgtgccgatcgcctat
gtcgtcaccgccggcaatcaggcgcagacatcgctcgccgatgtcgcctgcgcactgatc
gacgacccgcgtgtcacggcggtcggccttcatgtcgaaggtttcggcgatctctctgca
ctcgaacgcctggccaccatggcccgacggtcgaggaagccggtcgtcgtgctgaaggtc
ggcaggtccgagcaggcaaaacgcgcggcggtgtcgcataccgcctcgcttgccggcagc
gatgccgtcgcggatgccgtgctcgcccgcctcggcctcggccgcgtccagactctgccg
gcgctcttggaaaccctgaagctgctgcatgtcgccgggccgctcgcaagccattcgatc
tcgtcgatgagctgttccggaggcgaggcgtcgctgatggcggatgccgccgtcggtcgc
aacgtggaattcgcagccctgcagccgcaacaattgccccggctgcggcgggtcctcggc
gagatggtgacgctgtccaatccgctcgattaccacaccttcgtctggggggatctcgca
cgccagatcgaagccttcagcgccatgttcgagggcggctatgccctcaatctcgtcgtc
ctcgattttccgcgcggtgaccgctgcgatgcgtccgaatgggcgatgacggcagacgcg
gtcatgacggctgccgccgcaaccggtgcgctggccggccttctggcgacccttccggaa
aacatgccggagcccatcgccgatcggctgatggcaaacggcatcgttgccttctgcggc
atcgacgaaaccatcgtcgcggcggaagtcgccgccggcatcggccgggcgtgggatcgc
ccggctcccctgccgctgctcgacgtgtcccctatggacggcgaaatcgagacgttgacg
gaggccgatgcgaaggcggagctggccgctttcggccttccgattccgcgaggcctgttg
gcctcttctcccggtcaagcggccgagcaggccgagcggctcggtttccccgtcgtgctg
aaagcgctcggcattgcgcacaagaccgaggccggggccgtcgcgctcaacctggaggat
attaaggccgtgtcgaatgcggcagcggcaatgccgccgaatgccggttatctcgtcgag
aaaatgattgatccgccggtcgccgagctcattgtcggcgccatccgcgaccctgtcttc
ggattgtcgctcacgcttggagcaggcggaatcttcgttgaattgcttgaagattccatc
atcctgccacttccggcgacgaaaaccgacattcgcgcggcgatttcgcgcctcaaactt
gcaaaattgatcggtggctatcgcgggcggccaaaaggcgatctcgaagccgctgtcggc
gttgtctcagcaacggcagattatgtcgtaaagaacgcggcatgcttggaggaactcgac
attaatccattgatggttcttcccgaagggcgtggcgttgccgtagtcgatgccctgata
cggcgaaggaggtag

DBGET integrated database retrieval system