KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110242Help
Entry
pRL110242         CDS       T00402                                 

Definition
(GenBank) putative alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00052  Galactose metabolism
rle00561  Glycerolipid metabolism
rle00600  Sphingolipid metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    pRL110242
  Lipid metabolism
   00561 Glycerolipid metabolism
    pRL110242
   00600 Sphingolipid metabolism
    pRL110242
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     pRL110242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CAK03190
GeneDB: pRL110242
RhizoBase: pRL110242
UniProt: Q1M6E4
Position
pRL11:256907..258373
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFRDIEFALTDLSEHNLEMIKAILDRVVKANGL
PTKVTATTDRRQALEGARYIISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSLSELDYICSGINHQTWFIDLRLNGRRIGKDELIAGFEAHPVYSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITRWIDMSDWIHGETGGYLRHSTETRNWFETE
YPQFLESAAQPIDPAKRSNEHASHILEALETNRVYRGHFNVKNNGVITNLPSDAIIESPG
FVDRFGINMVSGVTLPEACAATCIASINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAQARWLPQYAHAVPAAKERLSKSKVQTRDWAGAARRNVRSIEELRAE
KAALKQAV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctatcatcggtgcgggcagcgtcggtttcaccaagaagctgttc
accgacatattgtgcgttcccgagtttcgcgacatcgaattcgcgctgaccgatctcagc
gaacacaatctcgagatgatcaaggccatcctcgaccgcgtcgttaaggcgaacgggctg
ccgacgaaggtgacggcgacgaccgaccggcgccaggcgctggaaggcgcgcgctacatc
atcagctgcgtccgggtcggcgggctcgaggcctatgccgacgatatcagaatcccgctg
aaatacggcatcgaccagtgcgtcggcgatacgatctgcgccggcggcatcctctatggc
cagcgcaacatcccggtcatcctcgacttctgcaaggatatccgcgaggtcgccgagccc
ggtgcgaaattcctgaactatgccaacccgatggcgatgaacacctgggcggcgatcgaa
tacggcaaggtcgataccgtcggcctctgccacggcgtccagcacggcgccgagcagatc
gccgaggtgctcggcgcaaagtcgctgagcgagctcgactatatctgctccggcatcaac
caccagacctggttcatcgaccttcgcctcaacggccgcaggatcggcaaggatgagctc
atcgccggcttcgaggcgcatccggtctattcgcagcaggagaaattgcgcatcgacgtg
ctgaagcgtttcggcgtctattccaccgaaagcaacggccatctctcggaatacctgccc
tggtatcgcaagcggccggatgaaatcacccgctggatcgacatgtccgactggatccat
ggcgagaccggcggctatctccgccattccaccgaaacgcgcaactggttcgagacggaa
tatccgcaattcctggaatccgccgcgcagccgatcgatcccgccaagcgctcgaacgaa
catgcaagccatatcctcgaggcgctggagacgaaccgggtctatcgcggccatttcaac
gtcaagaacaatggcgtcatcaccaacctgccgtccgatgcgatcatcgaatcgccgggc
ttcgtcgatcgcttcggcatcaacatggtctcgggcgtcaccctgccggaagcttgcgcg
gcgacctgcatcgcctcgatcaacgtccagcgcatgtcggtgcatgcggcgatatcgggc
gacatcgacctcttgaagcttgccgtgctgcacgacccgctggtcggcgccgtctcgacg
ccggaagaggtctggcagatggtcgacgagatggtcgttgcccaggcgcgctggctgccg
caatatgcccatgccgtgccggccgccaaggagcggctgtcgaaatcgaaggtgcagacc
cgcgactgggcgggggccgcacgccgcaacgttcgctcgatcgaggagctgcgcgcggaa
aaggcggcgctgaaacaggccgtctga

DBGET integrated database retrieval system