KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110632
Entry
pRL110632         CDS       T00402                                 

Gene name
cobF
Definition
(GenBank) precorrin-6a synthase [deacetylating]
  KO
K02228  precorrin-6A synthase [EC:2.1.1.152]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00860  Porphyrin and chlorophyll metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    pRL110632 (cobF)
Enzymes [BR:rle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.152  precorrin-6A synthase (deacetylating)
     pRL110632 (cobF)
SSDB
Motif
Pfam: TP_methylase
Other DBs
NCBI-ProteinID: CAK03586
GeneDB: pRL110632
RhizoBase: pRL110632
UniProt: Q1M5A3
Position
pRL11:complement(683245..684009)
AA seq 254 aa
MKHINIIGIGTGNPEHLTIQAINAMNAADVVFLPVKGAGKEELAEIRREICERYISRPAG
RVSEFAVPQRQTADKTYVQSVDTWHGEIAGIYGELISGLPEEGRGAFLVWGDPSLYDSTI
RIIERVRQEGSLDFDYSVIPGITSIQALAASHRTPINLVGKPIEITTGRRLARDGLLTDS
TIVMLDGEQAFAKIDDPDAEIFWGAYLGTKDEIVRAGRLGDIATDILRLRTEARQRHGWI
MDIYLLRKGRDFEE
NT seq 765 nt   +upstreamnt  +downstreamnt
ttgaagcatatcaatatcatcggcatcggcacgggcaacccggagcacctcaccatacag
gcgatcaatgcgatgaacgcggccgacgtggtcttcctgccggtcaagggcgccggcaag
gaagagctcgccgagatccggcgggagatctgcgaacgctatatcagccggccggccggc
agggtttcagaattcgcggtgccgcaacggcagacggccgacaagacctatgtgcagagc
gtcgatacttggcatggcgagatcgccggcatctatggagaactgatctccggtctcccg
gaggagggccgcggcgcctttctcgtctggggcgatcccagtctctacgacagcacgatc
cgcatcatcgaacgcgtgcgccaggaaggcagcctggatttcgattacagcgtcattccc
ggcatcaccagcattcaggcgctggcggccagccacagaaccccgatcaacctcgtcggc
aaaccgatcgagatcaccacaggacgcaggctggcgcgggacgggcttctgaccgacagc
accatcgtcatgctcgacggcgaacaggcttttgcaaagatcgacgatcccgatgccgag
atcttctggggcgcctatctcggtaccaaggacgagatcgtcagagcagggcgacttggc
gatatcgccaccgacattctgaggctcaggaccgaggccaggcaacggcacggctggatc
atggacatctatctcctgcgcaagggacgggatttcgaggaatag

DBGET integrated database retrieval system