KEGG   Rhizobium johnstonii: pRL120201
Entry
pRL120201         CDS       T00402                                 
Symbol
eryF
Name
(GenBank) erythritol permease, component of ABC transporter
  KO
K17203  erythritol transport system permease protein
Organism
rle  Rhizobium johnstonii
Pathway
rle02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    pRL120201 (eryF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    pRL120201 (eryF)
Transporters [BR:rle02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Erythritol transporter
    pRL120201 (eryF)
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: CAK11913
RhizoBase: pRL120201
UniProt: Q1M4Q8
Position
pRL12:complement(209242..210294)
AA seq 350 aa
MSVTNVTEKKSVSSGPKRNTNIVRLILEGRAFFALIVIIAVFSFLSPYYFTLNNFLIMAS
HVAIFGILAIGMLLVILNGGIDLSVGSTLGLAGCIAGFLMQGVTLTYFGVILYPPVWAVV
VITCALGALVGAVNGVLIAYLKVPAFVASLGVLYVARGIALLMTNGLTYNNLGGRPELGN
TGFDWLGFNRLAGIPIGVIVLAVLAIICGIVLSRTAFGRWLYASGGNERAADLSGVPVKR
VKIIVYVLSGVCAAIAGLVLSSQLTSAGPTAGTTYELTAIAAVVIGGAALTGGRGTVRGT
MLGAFVIGFLSDGLVIIGVSAYWQTVFTGAVIVLAVLMNSIQYGRRVKSS
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtcagtcacgaacgtcaccgaaaagaaatcagtttccagcgggccgaagcgcaatacc
aatatcgtgcgtctcatcctggagggccgggccttcttcgcgctgatcgtcatcatcgcg
gtcttctcattcctgtcgccctattacttcactctgaacaacttcctgatcatggcgtcg
cacgtcgcgatcttcggcattctggcgatcggcatgctgctcgtcatcctgaatggcggc
atcgacctttcggtcggctcgacgcttgggcttgcaggctgcattgccggtttcctgatg
cagggcgtcacgctcacctatttcggcgtcatcctctatccgccggtctgggccgtcgtc
gtcatcacatgtgcgctcggtgcgctggtcggtgcagtcaacggcgtgctgatcgcctat
ctcaaggtgccggccttcgtcgcctcgctcggcgtgctctacgtcgcccgcggtatcgcg
ctcttgatgaccaacggcctgacctacaacaatctcggcggccgtccggaactcggcaat
accggcttcgactggctcggcttcaaccggctcgcaggcattccgatcggggtcatcgtg
cttgcggttctcgccatcatttgcggcatcgtgctgagccgcaccgccttcggccgctgg
ctctacgcctctggtggtaacgagcgggccgccgacctctccggcgtcccggtcaagcgc
gtgaagatcatcgtctatgtgctttcgggcgtctgtgccgcaatcgccggcctagtcctc
tcctcgcagctgacctcggccggtccgacggcaggcacaacctacgagctgacggcaatc
gcagccgtggtcatcggcggagcggcgctgaccggcggccgcggtacggttcgcggcacc
atgctcggcgccttcgtcatcggcttcctttcggacggcctcgtgatcatcggcgtctcg
gcctactggcagacagtattcaccggcgctgtgatcgttctcgccgtcctcatgaacagc
attcaatacggccgccgggtcaaatcgtcctga

DBGET integrated database retrieval system