KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120390Help
Entry
pRL120390         CDS       T00402                                 

Definition
(GenBank) putative permease component of ABC transporter
  KO
K17203  erythritol transport system permease protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
Module
rle_M00590  Erythritol transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    pRL120390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rle02000]
    pRL120390
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Erythritol transporter [MD:M00590] [OT]
    pRL120390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: CAK12099
GeneDB: pRL120390
RhizoBase: pRL120390
UniProt: Q1M473
Position
pRL12:complement(422258..423322)
Genome map
AA seq 354 aa AA seqDB search
MMAATSTTLAPKGANGSALLTLMKLRTFIALFAVIIFFAIFAPNFTSTANMILMSKHVAL
NAFLVMGMTFVIITGGIDLSVGSIVGLCGMVAGGLILYGIELPIGYTIFFNLFEIVLITL
SIGLLIGLINGLLITKLNVAPFIATLGTLYIARGLALLSSDGQTFPNLVGRPEYATTGFD
FFGAGRILGLPVSIWILIVLALLAAYVARSTPIGRHIFAVGGNERAARMSGIRVDVVKIF
VYMFSGLCAAIVGVVISSELMAAHPATGESFELNAIAAAVLGGTSMSGGRGTIGGTIIGA
FVIGILSDGLVMMGVSSFWQMVIKGLVIIIAVVVDQAQRRLQQRVTLMQMAKAG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggctacatcaaccactcttgcgccgaagggcgccaacggctcggcacttctg
acactgatgaagctcaggacgttcatcgcgctgttcgctgtcatcatcttctttgcgatc
ttcgccccgaacttcacctcgacggcgaacatgatcctgatgtcgaagcatgtggcgctg
aacgccttcctggtgatgggcatgaccttcgtcatcatcaccggcggcattgatctctcg
gtcggatcgatcgtcgggctttgcggcatggtcgccggcggcctgatcctttacggcatc
gaattgccgatcggctacaccatctttttcaacctcttcgagatcgtgctgatcaccttg
tcgatcggcctgctcatcggtctgatcaacggcctgctgatcaccaagctcaacgtcgcg
cccttcatcgccacgctcggcacgctctatatcgcccgcggtctcgctttgctgtcatcg
gacggccagacctttccgaaccttgtcggccggcctgaatatgccacgaccggcttcgat
ttcttcggcgcaggacgcattctcggcctgccggtgtcgatctggatcctgatcgtgctt
gcgctgctggcggcctatgtcgcccgctcgacgccgatcggccgtcatatcttcgccgtc
ggcggcaatgagcgtgccgcgcgcatgtccggtatccgggtcgatgtcgtgaagatcttc
gtctacatgttctccggactttgcgcggcaatcgtcggcgtcgtcatctcctccgagctg
atggcagcccatccggcaaccggcgaaagcttcgaactcaatgcgattgccgcagccgtg
cttggcggcacctcgatgtcgggcggccgcggcacgatcggcggcacgatcatcggcgcc
ttcgtcatcggcatcctctccgacgggttggtgatgatgggcgtctcctccttctggcag
atggtcatcaagggcctggtcatcatcatcgccgtcgtggtcgaccaggcgcagcgccgc
ctgcagcagcgcgtcaccctcatgcagatggcaaaggcaggttga

DBGET integrated database retrieval system