KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120391Help
Entry
pRL120391         CDS       T00402                                 

Definition
(GenBank) putative ATP-binding component of ABC transporter
  KO
K17204  erythritol transport system ATP-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
Module
rle_M00590  Erythritol transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120391
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Erythritol transporter [MD:M00590] [OT]
    pRL120391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_23 AAA_29 AAA_13 AAA_30 AAA_15 DLIC
Motif
Other DBs
NCBI-ProteinID: CAK12100
GeneDB: pRL120391
RhizoBase: pRL120391
UniProt: Q1M472
Position
pRL12:complement(423319..424869)
Genome map
AA seq 516 aa AA seqDB search
MTTAEAQKDDVILRLDDVSKVYSGIVAVKRANLELRRGAVNVLVGENGAGKSTLMKIIAG
VERPTLGRIILDGKPVSFDSPAHAQANGIGMIFQELNLFANMSVAENIFARREITRGILG
IDHKAQVQKANAFLKRLDAGIEADTMVEDLPIGQQQLVEIAKAMSLNARILIMDEPTSAL
SAAEVEILFKVIAELKAQGVAIVYISHRLEELMRIGDYITVLRDGQVTGEAMVRDIDTRW
IVRSMIGSDAKDFAKSVDHAVGAEVFRAENISLPRPTGGLSVNDVSLSVKAGEILGIYGL
MGAGRSEFFECVIGRHTHSTGKIFIDGKHVRARDTTRRIRRGLALIPEDRQREGLVQVLS
IASNLTLASLGRFTRLFHIDRGAEKSAIRDAIRDLSIKAPNPDFEVTSMSGGNQQKVVIG
KALMTNPKVLLMDEPSRGIDVGAKADVFRTMRRLAANGLAILFSTSDLEEVMALSDRIAV
LSNGQLVAVFDRNEATEEAIIAASAKGHGHQGKLAS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcagaggcacaaaaggacgatgtcatcctgcgcctcgatgacgtgtcgaag
gtctattccggcatcgtcgccgtcaagcgcgccaatctcgagcttcgccgcggcgcggtg
aacgtccttgtcggcgaaaacggtgctggcaagtcgacgctgatgaagatcatcgccggt
gtcgagcgtccgacgctcggccgcattatcctggatggcaagcccgtatccttcgacagc
ccggcgcacgcgcaggcgaatggcatcggcatgatcttccaggagctcaatctcttcgcc
aacatgtcggtcgccgagaacatcttcgccaggcgtgagatcacccgcggcatcctcggc
atcgatcacaaggcacaggtgcaaaaagccaatgcgtttctgaagcgtctggatgccgga
atcgaggcggatacgatggtcgaggatttgccgatcggccagcagcagctcgtcgagatc
gccaaggcgatgtcgttgaatgcccgtatcctgatcatggacgagccgacgtcggcgctt
tcggcagccgaagtcgagatcctgttcaaggtgatcgcggaactgaaggcccagggtgtg
gcgatcgtctatatctcgcaccggctcgaggagctgatgcggatcggcgactacatcacg
gtgctgcgtgacggccaggtcaccggtgaggcaatggtccgcgacatcgacacacgctgg
atcgtgcgctcgatgatcggctcggatgccaaggattttgcaaaatccgtggaccacgcc
gtcggagccgaggtctttcgcgccgaaaacatcagcctgccgcggccgacgggtgggctt
tcggtcaatgatgtctccctgtcggtcaaggcaggcgaaatcctcggcatctacggcctg
atgggcgccgggcgcagcgaattcttcgaatgcgtgatcggccggcacacacactcgacc
ggcaagatcttcatcgacggcaagcatgttcgcgcccgcgacaccacgcggcgcatccgc
cgcggccttgcgctcattccggaagaccggcagcgcgaaggtctggtccaggtgctctcc
atcgcctccaatctgacactggcgagccttggccgcttcacccggctcttccatatcgac
aggggtgcggagaagagtgccattcgcgatgcaatccgcgatctttcgatcaaggcgccg
aacccggatttcgaggtgacctcgatgtcggggggcaatcagcagaaggtcgtcatcggt
aaggcgttgatgaccaatccgaaggtgcttctgatggacgagccgagccgcggcatcgat
gtcggcgccaaggccgatgtcttccgcaccatgcggcggctggcggcaaacgggctcgcc
attctgttttcaacttccgaccttgaggaggtcatggcgctttccgatcgcatcgcggtc
ttgagcaacggccagctggtcgccgtcttcgaccgcaacgaggcgacggaagaagccata
atcgcggcttcggccaagggacacggacatcaagggaaactcgcgtcatga

DBGET integrated database retrieval system