KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120397Help
Entry
pRL120397         CDS       T00402                                 

Definition
(GenBank) putative GntR family transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR TrmB PaaX FadR_C LexA_DNA_bind Rrf2
Motif
Other DBs
NCBI-ProteinID: CAK12106
GeneDB: pRL120397
RhizoBase: pRL120397
UniProt: Q1M466
Position
pRL12:430285..431043
Genome map
AA seq 252 aa AA seqDB search
MFSTRKLLGENILSQRDVMTQPLEQIVRRKLSDEVFDRLERMITSGELQPGDEMPSERVL
MERFGVGRPAIREAMQSLANKGLVSISHGERAKVLRLTAKSIFRQVDLTAKIMLSQSSDS
LEYLKSARIFFERGMAREAAQRASANDIADLRNVIERQRMSLGRAEEFIDADMEFHTRIA
QISGNPIYVAVSEAMLAWLKEYHTEMLIWTGKEKFTLAEHDEIVDRLEANDVDGSETALL
KHLERSRALYAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgttctcgacacggaaactgttaggagaaaacattttgagccagcgagatgtgatgacc
caacccctcgaacaaatcgtccgccggaaactctctgacgaagtgtttgatcgacttgag
cgaatgatcacctcgggcgagcttcagcccggcgacgaaatgccgtccgagcgggtgctg
atggaacgcttcggcgtcggccggccggcgatcagggaggcgatgcagtcccttgccaat
aaaggtcttgtcagcatttcgcatggcgagcgggcgaaggtcctcaggctgacggcaaag
tcgatattccgtcaggtcgatctcaccgccaagatcatgctgtcgcaatcgtcggactcg
ttggaatatctgaagagcgcgcgcatcttcttcgagcggggcatggcgcgcgaggcggcg
cagcgggcctccgcaaatgatatcgctgacctcaggaatgtcatcgaacgccagcgcatg
tcgcttggccgggcagaagagttcatcgacgcggacatggaattccacacccgcatcgcg
cagatatcaggcaacccgatctacgtcgccgtcagcgaagcaatgcttgcctggctgaag
gaatatcataccgagatgctgatctggaccggcaaggaaaaattcacgctcgccgaacac
gacgagatcgtcgaccgccttgaagcaaacgacgtggatggctcggaaacggcactcctc
aagcatctcgagcggtcgcgagcgctttacgcgaagtaa

DBGET integrated database retrieval system