KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120401Help
Entry
pRL120401         CDS       T00402                                 

Gene name
dctQ
Definition
(GenBank) putative TRAP transporter transmembrane C4-dicarboxylic acid DctQ component
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctQ
Motif
Other DBs
NCBI-ProteinID: CAK12110
GeneDB: pRL120401
RhizoBase: pRL120401
UniProt: Q1M462
Position
pRL12:433719..434291
Genome map
AA seq 190 aa AA seqDB search
MSQEIHTQITAEEIGHEFEGHAPTANVSDYAIEDWITLLVFWLMAGCVFLQFFTRYVLND
SYAWTEEIAINCLIGVVFLGSVMCVRTSRHIQVDVFYHYMPASLARVLATFVDIVRIGFF
AYGCHLMWRYVDIVADEQMVTIDLPRNIVFYSVLVAFVLMLIRAVIVFIANMRRGYSVLE
RPEEFQTVEG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagaaatccatacgcaaattacggccgaagaaatcggtcacgagttcgaagga
cacgcgccgaccgctaacgtctcggattacgctatcgaagactggatcacgctgctcgtc
ttctggctgatggccggttgcgtcttcctgcaattcttcacgcgctatgtgctgaacgac
agctacgcatggaccgaggagatcgcgatcaactgcctgatcggcgtcgtctttctcggt
tccgtcatgtgcgtgcgcacctcgcggcatatccaggtggatgtgttctatcactatatg
ccggcaagccttgcgcgcgtgctcgccactttcgtcgatatcgtccgcatcggcttcttc
gcctatggctgccatctgatgtggcgttacgtcgacatcgtcgcggacgagcagatggtc
accatcgacctgccgcgcaacatcgtcttctacagcgttctcgtcgccttcgtgctgatg
ctgatccgcgcggtcatcgtcttcatcgccaacatgcgccgcggctactccgttctggag
cgccccgaagaattccagaccgtcgagggttga

DBGET integrated database retrieval system