KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120402Help
Entry
pRL120402         CDS       T00402                                 

Gene name
dctM
Definition
(GenBank) putative large transmembrane TRAP C4-dicarboxylate membrane transport protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctM
Motif
Other DBs
NCBI-ProteinID: CAK12111
GeneDB: pRL120402
RhizoBase: pRL120402
UniProt: Q1M461
Position
pRL12:434296..435702
Genome map
AA seq 468 aa AA seqDB search
MLLLLGSFLVLMLIGVPVAISMAVASVLYIVLYGVAPDIIVAQRMIAGVESFPLLAVPFF
ILAGNLMNSAGVTGRIYSFAVALVGWMKGGLAQVNIIGSVIFSGMSGTALADAAGIGTIE
IKAMKDHGYPVEAAVGVTAASATLGPIFPPSLPFVIYGMMANVSIGALFMAGILPGIVMT
LLMMITVAAFAYKKRWGSDAPFNVRELLSAGMEIVVVLAVPLAIYLMMRAGVSMNVAAGI
ALALLLALDWYFRFSAVMALMTPVILIGGMTMGWFTPTEAAVAAVLWSLFLGLVRYRTMT
PSTLAKASFDTIETTASVLFIVTAASVFAWLLTVSQAAQLLSDAILSITDNKWVFLILVN
LLMLFVGCFLDTIAAITILVPILLPIVLKFGIDPVQFGLIMTLNLMIGLLHPPLGMVLFV
LSRVAKLSVERTTMAILPWLVPLFLALILITFVPAISLWLPQQLGLLR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcttctaggttcgttcctggtgttgatgctgatcggggtgcccgtcgccatt
tcgatggccgtcgcatccgtgctctacatcgtcctttatggcgtcgcgccggacattatc
gtcgcccagcgcatgatcgccggcgtcgaaagcttcccgctgctcgccgtgccgttcttc
atcctcgcgggcaacctgatgaactcggccggtgtcaccggccgcatctattcctttgcc
gttgctctcgtcggctggatgaagggcggtctcgcgcaggtcaacatcatcggttcggtg
atcttctccggcatgtcgggcaccgcgcttgccgatgccgcgggtatcggcacgatcgag
atcaaggcgatgaaggatcacggctatccggtcgaggccgcggtcggcgtgacggcggcc
tcggcaacgctcggcccgatcttcccgccatcgctgcctttcgtgatctacggcatgatg
gcgaacgtctcgatcggcgctcttttcatggcgggcatcctgcccggcatcgtcatgacg
ctgttgatgatgatcacggtcgccgcctttgcttataagaagcggtggggctcggatgcg
ccgtttaatgtcagagagctcctatcggcggggatggaaatcgtcgtcgtcctggcggtg
ccgctggccatctatctgatgatgcgggccggcgtatcgatgaatgttgcggcgggcatt
gctcttgccctccttctagccctcgactggtatttccgcttctccgccgtcatggcgctg
atgacgcccgtcatcctgatcggcggcatgacgatgggctggttcacgccgacggaggca
gccgtcgcagccgtcctctggtctctgttcctcggtctggtgcgttaccgcacgatgacg
ccctcgacgctcgccaaggcaagcttcgatacgatcgagacgacggcatccgttctcttc
atcgtcaccgcggcatcggtcttcgcatggctgctgacggtaagccaggcggcccagctg
ctgtccgatgcaatcctgtcgatcaccgacaataaatgggttttcctgatcctcgtgaac
ctgctgatgctcttcgtcggctgcttcctggacacgatcgcggccatcaccatcctcgtg
ccgatccttctgccgatcgtcctgaaattcgggatcgatcccgtccagttcggcctcatc
atgacgctgaacctgatgatcggtctgttgcacccgccgctcggcatggtgcttttcgtg
ctgtcgagggtcgcgaaactttctgtcgaacgcacgaccatggcgatcctgccctggctg
gtgccgctcttcctggcgctgatcctgatcaccttcgtgcccgccatatcgctgtggctg
ccgcagcaactcgggctgctgagatag

DBGET integrated database retrieval system